KEGG   Fusarium verticillioides: FVEG_05063Help
Entry
FVEG_05063        CDS       T04869                                 

Definition
(RefSeq) CMGC/MAPK protein kinase
Organism
fvr  Fusarium verticillioides
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Seadorna_VP7 Gag_p6
Motif
Other DBs
NCBI-GeneID: 30063080
NCBI-ProteinID: XP_018749889
UniProt: W7M8C1
LinkDB All DBs
Position
4
AA seq 355 aa AA seqDB search
MSRSNPPNAAGSRKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHS
MFCLRTLREMKLLRYFNHENIISILDIQKPRNYESFNEVYLIQELMETDMHRVIRTQDLS
DDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSG
FMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILD
VLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPKTSDLALDLLEKLLAFNPVKRI
TVEEALKHPYLEPYHDPEDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYQEIMR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgatcgaacccccctaacgctgcggggtcccgcaagatctcgttcaacgtgagc
gagcagtatgatattcaggatgttgttggtgagggcgcctatggtgttgtctgctctgcc
attcacaagccctccggccaaaaggtcgccatcaagaagatcactcctttcgatcactcc
atgttttgtctaagaaccctgcgagagatgaagctgttgcgatatttcaatcacgagaac
atcatttccattctcgatatccagaagccccgaaactacgagtcatttaatgaagtttac
ttgatccaagaactgatggagacagatatgcaccgagtcatccgcacccaggacctttct
gacgaccactgccagtacttcatctaccagaccctccgcgccctcaaggccatgcactcg
gccaacgtactgcaccgagacttgaagccctccaacctcctcctcaacgccaactgtgat
ctcaaggtgtgcgattttggtcttgcgcgatccgctgcttcgcaggaggacaactccggt
ttcatgactgaatatgtcgcgactcggtggtaccgtgcgcccgagatcatgttgactttc
aaggagtacaccaaggccattgatgtgtggtcggttggctgcattctcgccgagatgctc
agtggcaagcccctgttccctggcaaggactaccaccaccagttgacactcattctggac
gtgctgggcacgcccactatggaagactactacggaatcaagtcgcgccgcgctcgagaa
tacattcgatcactccccttcaagaagaaggttcccttccgaactctgttccccaagacc
tcggatctggccctcgacctgctcgagaagctcctcgcattcaaccctgttaagcgcatc
accgtggaggaggctctgaagcacccataccttgagccttaccatgatcccgaggacgag
ccaacagcacccccgatccccgaggagttctttgactttgacaagcacaaagacaacctg
agcaaggagcagctgaagcagttgatctaccaggagattatgaggtaa

DBGET integrated database retrieval system