KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_4112Help
Entry
Glaag_4112        CDS       T01483                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Glaag_4112
Enzymes [BR:gag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Glaag_4112
Transporters [BR:gag02000]
 Other Transporters
  Pores ion channels [TC:1]
   Glaag_4112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AEE25036
UniProt: F4AMJ9
LinkDB All DBs
Position
complement(4868181..4868780)
Genome map
AA seq 199 aa AA seqDB search
MKIYGDEQSGNCYKVKLMCALLNIQHEWIHVDILAGGTNAQAFLAKNPNGKIPLLALDDG
RHLWESNAIINYLAMGSDFLPSDAFDLAKVQQWQFFEQYSHEPYIAVARFIAKYLGLPDS
KKAEYEAKQAGGHKALAVMETQLVQSAFLTGEHMSSADVSLYGYTHVAHEGGFDLSLYPA
VQAWLARIEALPKYIPMGQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacggggatgaacaatctggcaattgctacaaagtgaaactgatgtgcgcc
ttactgaatattcagcacgagtggatccatgtggacatattagccggtggtactaatgct
caagcatttttagccaagaacccgaatgggaaaatccctttacttgcccttgatgacggg
cgtcatttgtgggaatcaaacgctattattaattatttggcgatgggcagtgattttctg
cctagtgatgcatttgatttagcgaaagtgcagcaatggcaattttttgaacagtacagt
catgaaccttatattgcagttgctcgctttattgctaaatacctagggttacctgatagc
aaaaaagctgaatatgaagccaagcaagcaggcgggcataaagcacttgccgtgatggaa
acacaattagtgcaatcggcatttctcactggcgaacacatgagctcagcggatgtaagt
ttatacggctatacccatgtcgcgcacgaaggtggctttgatttgtccttgtatcctgcg
gtgcaggcgtggttagcacgcatagaagctttgccgaaatatattcctatggggcaatga

DBGET integrated database retrieval system