KEGG   Geoglobus ahangari: GAH_01738Help
Entry
GAH_01738         CDS       T03939                                 

Definition
(GenBank) Aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gah  Geoglobus ahangari
Pathway
gah00030  Pentose phosphate pathway
gah01100  Metabolic pathways
gah01120  Microbial metabolism in diverse environments
gah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gah00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GAH_01738
Enzymes [BR:gah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     GAH_01738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKG90981
UniProt: A0A0F7DBF1
LinkDB All DBs
Position
complement(1488570..1490417)
Genome map
AA seq 615 aa AA seqDB search
MGNGFMGSILRVDLSSGSLDVLDVDEEVARKYLGGKGYSVYLLWQYLKEYEKEGLSARDV
DPLGEENVLIFGTGPATGVAGFPEAGRYHVMALRSPLTGSIASANSGGKWGPYLKFAGFD
MIVIEGASSEPVYLEIIDGVAELRKASDLWGRSVFDTTAILERRYEEKVSVACIGPAGEN
LVNYAAIMNDYHRAAGRTGVGAVMGSKMLKAIVVGGSFRPEIAKPDEFKEATKSALDKIK
QNPVTGEGLPKYGTAVLVNVINESGALPYKNWQGAYHEKANDISGETMAEKYLDRNHACW
GCSIACGRATSVKKGPWQVLNSEGPEYESIWSLGNDTGVIDLEAIIKANHLCDELGLDTI
SMGSAIACAMELYERGKLTLEDTQGIEYNFGNPVALVDGVWKTAYRIGVGKYLALGSKRM
AEIFGLDVSMSVKGLEMPAYDPRGIKGIGLNYATANRGGCHVTGYTVSPEIIGLPEKIDP
LTYEGKAQWVKVFQDFTSTVNSTVNCLFTTFALGADDYASLLSAVTGWDMGAEDILTIGE
RIYNLERLIINKFGFNGKDDTLPRRLFEDPVPEGPTKGQVVSKEDFEKMKEEYYRLRGWV
NGVPTEEKLKELGIV
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacggttttatggggagtatattgagagtggatctttcgagcgggtctcttgac
gtgcttgatgtagacgaggaggttgcaaggaagtacctcggcggaaagggctattccgtc
tacctgctgtggcagtacctgaaggagtacgagaaggagggtctttcagcgagagatgtt
gacccgcttggagaggagaacgttctcatctttggcaccggccctgcgaccggtgttgct
ggttttccggaggcgggcagataccacgtgatggccctgagaagcccgctcacaggctcc
atcgcctcggcgaacagcggtggaaagtgggggccgtacctgaagttcgcaggcttcgac
atgatcgtgattgagggcgcgtcgagcgagcccgtgtacctcgagattattgacggtgtg
gccgagctgaggaaggcgagcgacctctggggcaggagcgtttttgacaccacggcgatt
ctggagagaaggtacgaggagaaggtcagcgtcgcgtgcatagggcctgcaggagagaac
ctcgtgaactatgctgcgataatgaacgactaccacagggcggcaggcagaactggtgta
ggagcggtgatgggcagcaagatgctgaaggcgatagtcgtcggagggagcttcaggccg
gagattgccaagccggatgagttcaaggaggcgacaaagagcgcgctcgacaagataaag
cagaaccccgtcacgggagaggggctgcccaagtacggtactgccgtgcttgtgaacgtg
ataaacgagagcggcgctctgccctacaagaactggcagggcgcataccatgagaaagcc
aatgacataagcggagagacgatggcagagaagtacctcgacaggaaccacgcctgctgg
ggatgctctatcgcatgcggcagggcaacttcggtgaagaaggggccgtggcaggttctc
aactccgaggggcctgagtacgagtcgatctggagccttggaaacgacacgggcgtgatt
gacctcgaggcgataatcaaggccaaccacctgtgcgacgagctcggactggacacgatt
tccatgggctcggccatagcatgcgcgatggagctctacgagaggggcaagctcacactc
gaggacacgcagggcatagagtacaacttcggcaaccctgtagctctcgttgatggagtc
tggaagactgcttacaggataggggttgggaagtatctggctctcggctcgaagagaatg
gcggagatatttggcctcgacgtctcaatgagcgttaagggcttggagatgcccgcttac
gatccgaggggcataaagggcataggcctgaactacgcaacagccaacagaggcgggtgc
cacgtcaccggctacacggtgagtccggaaatcatcggcctgccggagaagatagacccg
ctcacgtacgagggcaaggcgcagtgggtcaaggtgttccaggacttcacgtccaccgtg
aactcaacggttaactgcctcttcacgaccttcgccctcggagctgacgactacgcgagc
ctcctctcagcagttacaggctgggacatgggtgcggaggacatcctgaccattggagag
agaatatacaacctcgagaggctgataatcaacaagttcggattcaacggcaaggacgac
acgctgccaagaaggctcttcgaggatccggttccggaggggccgacgaagggacaggtg
gtcagcaaagaggacttcgagaagatgaaggaggagtactacaggctgagaggctgggtg
aacggagtcccgacggaggagaagctgaaggagctcggaatagtctga

DBGET integrated database retrieval system