KEGG   Glutamicibacter arilaitensis KLBMP5180: AOZ07_15785Help
Entry
AOZ07_15785       CDS       T04229                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gar  Glutamicibacter arilaitensis KLBMP5180
Pathway
gar03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gar00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AOZ07_15785
Enzymes [BR:gar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AOZ07_15785
DNA repair and recombination proteins [BR:gar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AOZ07_15785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ALG30299
UniProt: A0A0N9JN33
LinkDB All DBs
Position
3414388..3416859
Genome map
AA seq 823 aa AA seqDB search
MARKEQFVEVAGRTLKVSNLDKVLYPATGTTKGEVMDYFQQVAPALLPHAAWRPATRKRW
VDGVGTAAEPGKVFFRKDLEESAPHWIPRAKLEHKTHANTYPMVNDEAVLAWIAQVAALE
IHVPQWRFDSSLDPANPDRLVLDLDPGPGTGLEQCAEVALICREILEGMKLPSIPVTSGS
KGIHLYAGLDGKYSSDQISEVAKELASALQKDHPQLVVSSMKRSLRENKVLVDWSQNNAA
KTTVCPYSLRGRSRPTVAAPRTWQEVEATGLEQLEYPEVLDRLQDGIDPLAPLAAGESAR
EDPDRLAVYRSKRDALQTPEPVPRQTATAGRTGSSQSADSGSSFVIQEHHARRLHWDFRL
EHDGVLVSWAVPKGPPLESGIQRLAVMTEDHPLSYGSFEGRIPKGQYGAGEVAIWDAGTC
RIEKWREGKEVIAVLQGKPGGGLGAIPRRFVLVHAPGMGGKNNWLLQLAKDQPAADTATD
DLASEPVQAAAYLSRRPPRPMLATAGTAEDISSTQDWSFEMKWDGYRAIGVARGGTLSLF
SRNGHELGADFPGLAELGCLLPDGSVVDGEIVALNEAGRPDFSLLQRYVAAMRKKQTRQA
RAISIQYLLFDALQLPSASGRPEDLTGLPYAERRRRLDSLTLEHQSAKIPPAYHGTVAEA
VRISQDIGLEGVVAKDCASLYEPGSRNGSWIKLKHEIHQEVIVIGWRKGLGARSSSFASL
LLAVPGRDGLRYAGRVGSGFSDAQLTAIRHRLEKLGRKTPPAKDIPAAHRRDAHWTSPKL
VGEVRYSELTGTGLLRHPVWRGLREDKEPHEVRWESTSIIETR
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaggagcaatttgtagaggtcgctggacgcaccctcaaggtcagcaacttg
gacaaggtcctgtatccggccaccggaaccaccaaaggcgaggtgatggactacttccag
caggttgccccggccctcttgccgcacgcagcttggcggcctgccacgcgcaagcgctgg
gtggacggggtcggcaccgccgcggaacccgggaaggtcttcttccgcaaggatctggaa
gagtccgcgccccactggatcccccgcgccaaacttgagcacaagacccacgccaatacc
tatccgatggtcaatgacgaagccgtgctggcatggatagcccaagtggccgccttggaa
atccatgtgccccagtggcgtttcgattcctccctggaccctgccaacccggatcgcctg
gtcctggatctggatcccggcccgggaaccggattggagcagtgcgcggaagtcgccttg
atctgccgggaaatcctcgagggcatgaagttgcccagtatcccggtgacctccggttcc
aaaggcattcacctgtatgcgggcctggatggaaaatacagctcggaccagatcagcgaa
gtggccaaggagctggccagcgcgctgcaaaaggaccatccgcagctggtggtctccagc
atgaagcgctccctgagggagaacaaggtgctggttgactggagccagaacaatgcagcg
aaaactaccgtctgcccctactcgttgcgcggccgctcccggcccaccgtcgccgcgccc
cggacctggcaggaagtcgaggccaccgggctggagcagctggagtaccccgaagtcctg
gaccggctgcaggacgggatcgacccgctggctccgctggccgccggcgaatcggccagg
gaagatcccgaccggctggccgtctatcgttccaagcgcgatgcattgcagaccccggag
ccggtaccccggcaaaccgccaccgcaggacgaaccggcagcagccagagtgcggattca
gggtcgagttttgtcatccaggaacatcatgcccgccggctgcactgggatttccgccta
gagcacgacggggtgctggtttcctgggcggtacccaaggggccgccgctggaatccggg
atccagcggctggccgtgatgaccgaggatcatcccctgtcctatgggagcttcgaaggg
aggatccccaagggtcaatacggcgccggtgaagtggccatctgggatgcgggcacctgc
aggattgaaaagtggcgtgaaggcaaggaagtcattgcggtactccagggcaagcccggg
ggtgggctcggcgctattccccggcgtttcgtgctggtccacgcaccgggtatgggaggg
aagaacaactggctgttgcagctggccaaggaccagcccgccgcggacactgcaacggat
gatctggcctcagaacctgtccaggccgcggcatacctgtcccggcggccgccacgaccg
atgctcgccaccgcaggtaccgccgaggacatttccagcacgcaggactggagctttgag
atgaaatgggatggctaccgtgccatcggcgttgccagaggcggaacgctctcattattc
agccgcaatggccacgaactgggcgctgattttccgggattggcagaactggggtgcctg
ttgccagacggttcggtggtcgatggcgaaatcgtggcattgaatgaggcgggcaggccg
gatttctccttgcttcaacgctacgtcgccgcgatgcgcaagaagcagacccggcaagcc
cgcgccatcagcatccagtacctgctcttcgatgcgctgcagctgccttcagcgtccggc
agacccgaggacctcaccggcctgccctatgccgaacgccgccgccgcttggattccctc
acgctcgagcatcaaagcgccaagatccctccggcctaccacggcacggttgccgaagcc
gtgcggatcagccaggacatcggcctggaaggcgtagtcgccaaggattgcgcgtcgttg
tacgagcccggaagccgcaacgggagctggatcaagctcaagcacgaaatccaccaggaa
gtcattgtcatcggctggcgtaaaggcctcggcgcacgaagcagcagcttcgcttcgctg
ctgctggccgtcccggggcgcgatgggctgcgctacgcgggccgggtgggcagcggattc
agcgatgcccagctcaccgcgatacgccatcggcttgaaaagctggggcgcaagactcct
cctgccaaggacatcccggcggcgcaccgccgcgatgcccactggaccagccccaagctc
gtgggcgaggtgcgctacagcgagttgaccggcaccgggctgctgcgccacccggtgtgg
cgaggcttgcgcgaggacaaggaaccgcacgaggtccggtgggaatccacctcgatcatc
gaaacaagatag

DBGET integrated database retrieval system