KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2068Help
Entry
GbCGDNIH1_2068    CDS       T00392                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00020  Citrate cycle (TCA cycle)
gbe00310  Lysine degradation
gbe00380  Tryptophan metabolism
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01120  Microbial metabolism in diverse environments
gbe01130  Biosynthesis of antibiotics
gbe01200  Carbon metabolism
Module
gbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gbe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GbCGDNIH1_2068
  Amino acid metabolism
   00310 Lysine degradation
    GbCGDNIH1_2068
   00380 Tryptophan metabolism
    GbCGDNIH1_2068
Enzymes [BR:gbe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GbCGDNIH1_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABI62966
UniProt: Q0BQD6
LinkDB All DBs
Position
complement(2313096..2315987)
Genome map
AA seq 963 aa AA seqDB search
MAGVDVLASAFSGANAAFIADMYARWASDPGSVDPSFARLFEALGDEERAVLAETEGASW
APRPHKVASVYEGSAAAESVTEASTSTITEESPRDSVRAATLDSIRALMMIRAYRVRGHL
EARLDPLGLQVPAPHPELDPRSYGFTETDLDHPVFIDGLLGRETATVREIVDILRRSYCG
PIGVEFMHIQDPRQKSWIQRRIEGGYWRRTITDQDRRTLLQQLTEAEGFEVFCQKKYVGT
KRFGLEGGESMIPALHAIIANAAAQGVNEIAIGMPHRGRLNTLVNIVRKPYTQVFSEFAG
AASKPDDVQGSGDVKYHLGTSADIESAGHTVHLSLQPNPSHLEAVDPVVVGKVRARQDMA
GDTRQRRSVMGILMHGDAAFAGQGLVYETLAMSQLIGYRTGGTVHVVVNNQIGFTTVPAH
AYSGLYCTDVAKAIQSPILHVNADDPEAVAFCARMVTDFRMEFGVDTVLDIVCYRRHGHN
ETDEPAFTQPLMYNAIRARKTTRTLYAEALAERGVVSADEGRRMWDSFNDTLEQAFSTAK
SYVPNKADWLEGHWAGMQQDVAKDDRVDEATALPHETLELVGDALSHIPEGFAVNPKIAR
QLEAKQKMIESGEGIDWATGEALAFGSLLLEGHRVRLSGEDCQRGTFSHRHAVLIDQENQ
NEYVPLNNIAPQQARIEIYNSLLSEAGVLGFEYGYTLADPRTLVLWEAQFGDFANGAQVI
IDQFLASGETKWLRMSGLTLLLPHGMEGQGPEHSSARLERYLQLCAERNMAVCNLTTPAN
YFHALRRQLKRNFRKPLVIMTPKSLLRHKLAVSSLAEMTGDTAFQTVIPEIDTLVAPEKV
RRVVMCSGKVYYDLLAQRREAGIDDIAIIRLEQLYPFPKNSLSRVISCYSNADVIWCQEE
AANNGAWTFVDRKIEAVLNSIGGKATRPSYVGRAEAASPATGLAKVHQAQQDRLVREALG
LIS
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgtggatgtgttggcttctgccttcagcggcgcaaatgcagctttcattgcg
gatatgtatgcgcgatgggcctctgatcccggttctgttgatccaagctttgcgcgcctg
ttcgaagccctgggtgatgaggaacgggctgttctggccgagacggagggtgcttcatgg
gcaccccgcccacacaaggttgcctcggtctatgaaggcagtgctgcggcagaatctgtc
acggaagcatccaccagcacgatcacggaagaatctccgcgtgacagcgtgcgggctgcc
acgctggacagtattcgtgccctgatgatgatccgcgcctatcgtgtgcgcggccatctg
gaggcgaggctggacccgctggggttacaggtgcctgctccgcacccggaactcgatcca
cgcagctatggttttaccgaaaccgatcttgatcacccggtcttcatcgatggcctgctg
gggcgtgaaactgcgaccgtgcgggaaattgtcgatattctgcgccgctcctattgcggc
ccgatcggcgtcgagttcatgcatattcaggatccgcgccagaaaagctggatccagcgc
aggattgagggaggatactggcgccgtaccattaccgatcaggatcgccgtactctgttg
cagcaattgacggaagctgaaggtttcgaagtcttctgtcagaagaaatatgtcggcacc
aagcggtttggtctggaagggggcgagtcaatgattcccgccctgcatgcgatcattgcc
aatgcagctgcacagggcgtgaatgaaatcgcgatcggcatgccgcatcgcggccgcttg
aatacgctcgtcaacattgtgcgcaaaccttacacgcaggtgttcagcgaatttgcaggg
gcagcctcgaaacccgacgacgtgcagggatcgggggatgtgaaatatcatctcgggacg
tctgccgatatcgagagcgccggtcacacggtgcatctgtccttgcagcccaacccgtcc
catctggaagccgttgatccggtggtcgtcggcaaggtacgcgcccggcaggatatggcg
ggggataccagacagcggcgttccgtgatgggcatcctgatgcatggtgatgccgctttc
gccggtcagggactggtctatgagactttggcgatgagccagctcattggctaccgcact
ggtggcacggtgcatgtggtggtcaataaccagatcggatttaccactgttccggcacat
gcctattccggactttattgtaccgatgtcgcgaaagccattcagtcaccgatactgcac
gtcaatgcggatgatccggaggcggttgctttctgtgcccgtatggtcacggatttccgg
atggagttcggtgtcgataccgtgctggatatcgtctgttatcgccgccacggacataac
gaaaccgacgagcccgccttcacacagccgctgatgtataatgccatccgcgcccgcaag
accacccgtactctgtatgcggaagccctggcggagcggggtgtcgtttctgccgatgaa
ggccgtcggatgtgggattcttttaacgatactctggaacaggctttcagcaccgcgaaa
tcctatgtgcccaacaaggcggactggctggaaggccactgggccggcatgcagcaggat
gtcgcgaaagatgatcgcgttgatgaagcaaccgccctgccgcatgaaaccctggaactg
gtcggcgatgcgttgagccatatcccggaaggctttgcagtcaatccgaaaattgcccgt
caactcgaagcaaaacagaaaatgatcgagagcggcgaggggatcgactgggccaccggc
gaggcactcgcctttggctccctgctgctggaagggcatcgggttcgtctttcaggcgag
gactgccagcgtggcacgttcagccatcggcatgcggttctgatcgatcaggaaaaccag
aacgaatatgtgccgctgaacaatatcgccccgcagcaggcacggatcgagatctataat
tcgctactttcggaagccggtgtgctgggcttcgaatatggctatactcttgccgatcca
cgcacgctggtgttgtgggaagcgcagttcggtgatttcgccaacggtgcgcaggtcatc
attgatcagttcctggcgagcggcgaaacgaaatggctgcgcatgtcgggtctgaccttg
ttattgccacacggcatggaagggcaggggccggaacattcctctgcccgtctggaacgt
tatcttcagctctgtgccgagcggaacatggcggtgtgtaatctgaccaccccggcgaat
tacttccacgctctacgtcgtcagttgaagcggaatttccgcaagccgctggtgatcatg
acgccgaaatcactgctgcggcacaagctggcggtctccagcctggcggagatgaccggc
gatacggcgttccagaccgtgatccctgaaatcgatacgctggttgcgccggagaaagtg
cgccgcgtggtgatgtgctccggcaaagtctattacgatctgctggcccagcgtcgtgaa
gccgggatcgatgacattgccatcatccgtctggagcagctttatccattccccaaaaac
agcctctcccgcgtcataagctgctacagcaatgcggatgtgatctggtgtcaggaagaa
gccgccaataacggtgcctggactttcgtcgatcgcaagatcgaagcggtgctgaacagc
atcggcggcaaggcgacccgtccctcctatgttgggcgggccgaggcagccagccctgcg
accgggctggccaaggtgcatcaggctcagcaggacaggctggtgcgtgaggcgctgggg
ctgatctcctga

DBGET integrated database retrieval system