KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2218Help
Entry
GbCGDNIH1_2218    CDS       T00392                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GbCGDNIH1_2218
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GbCGDNIH1_2218
Enzymes [BR:gbe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GbCGDNIH1_2218
Peptidoglycan biosynthesis and degradation proteins [BR:gbe01011]
 Precursor biosynthesis
  Racemase
   GbCGDNIH1_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2467187..2468269
Genome map
AA seq 360 aa AA seqDB search
MARLEIDLEAIAANWRFLRTTHGTNRITGAVVKADGYGLGAAVIAQRLVQEGCDHIFVAH
PQEALTLRPLIPSATLIVLNGLWPGWEAAYTDHGLIPALGSLAEIEAWRQEATRREQALP
AFLHVDTGINRLGLDPQERDRLAERPELLDGITLRAIMTHLISAEIPDHDSNTLQRQRFA
AACSRLPPAPRSIANSSGIFLGPDFASDIARPGAALYGINPVPGRPNPMRPVLRLSARVL
QIRPVEAGEIVGYNGIWVAQRPSRIAVCSVGYADGFQRALSSRAEAAFDGARIPLVGRVS
MDLTTYDVTDDPRITVGSWLELIGPEVSPDEVAARASTNGYEVLTSLGRRYERVYRPLTP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtggcacggctggagatcgatctggaggccattgccgccaactggcgctttctgcgtacg
acccatggtacgaatcgcatcaccggggccgtggtcaaggcggacgggtacgggctgggg
gccgccgtcattgctcaacgtctggtgcaggagggatgcgatcacattttcgtggcccat
ccgcaggaagccctgacgcttcgtccgctgattccatccgccacgttgatcgtgctgaat
ggcctgtggcccgggtgggaagctgcttatacggatcatgggctaatcccggcgctcggc
tccctcgctgaaatcgaggcatggcggcaggaggcaacccgccgcgaacaggccctgccc
gcttttctgcatgtggataccggcatcaaccggctggggctggacccgcaggaacgtgac
cggctggccgaacggcccgagctgctggacggcattacgctacgggccatcatgacccat
ctgatcagcgctgaaattcccgaccatgacagcaatacacttcagcgccagcgttttgct
gccgcgtgcagccgcctgccgcctgctccgcgcagcatcgccaattcctccggtattttt
ctggggccggattttgccagcgacatcgcccggcccggggctgcgctgtatggcatcaat
ccggttccaggccgcccgaacccgatgcgccccgtgttgcggctctctgcaagagtgctt
cagatcagaccggtcgaagctggggagatcgtaggttataatggtatctgggtcgcccag
cgtccctcccggatcgcggtgtgttcagtcggatatgcggatggtttccagcgtgccctg
agcagccgggcagaggccgcttttgacggggcacgcattccactggtaggccgtgtctcc
atggacctgacgacctacgacgtcactgacgatccccgtatcacggtaggctcctggctg
gagcttatcgggccagaggtatcccccgatgaagtcgccgcacgcgccagcacgaacggg
tatgaggtgctgacctccctcgggcggcgctatgagcgtgtttatcggcctttgacccca
tga

DBGET integrated database retrieval system