KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0552Help
Entry
GbCGDNIH2_0552    CDS       T03083                                 

Definition
(GenBank) Protein translation elongation factor Tu (EF-TU)
  KO
K02358  
elongation factor Tu
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Brite
Translation factors [BR:gbh03012]
 Eukaryotic Type
  Elongation factors
   GbCGDNIH2_0552
 Prokaryotic Type
   GbCGDNIH2_0552
Mitochondrial biogenesis [BR:gbh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GbCGDNIH2_0552
Exosome [BR:gbh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GbCGDNIH2_0552
  Exosomal proteins of breast cancer cells
   GbCGDNIH2_0552
  Exosomal proteins of colorectal cancer cells
   GbCGDNIH2_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
637680..638870
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEERARG
ITISTAHVEYETGNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDPELLDLVEMEVRELLSSYQFPGDDIPIIKGSALCALE
DKNPEIGRDAILKLMEAVDAYIPQPERPLDRPFLMPIEDVFSISGRGTVVTGRIERGEVK
VGDEVEIVGLKATSKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHTKFAAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVSLPEGTEMVMPGDNVS
MQVELIAPIAMDEGLRFAIREGGRTVGAGVVAKISQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgaaatttgagcggaacaaaccgcactgcaacatcggcacgatcggacat
gttgatcatggcaagacgtcgctgacagcagctatcacgaaggtgcttgccgaaaccggc
ggcgcaactttcaccgcgtatgaccagatcgacaaggcgccggaagaacgcgcccgtggt
atcacgatttccacggcgcacgtggaatatgaaaccggcaaccgtcactacgcgcacgtg
gattgccccggtcacgccgactatgtgaagaacatgatcaccggcgcggcccagatggat
ggcggcattctcgtcgtctccgctgctgacggtccgatgccgcagacccgtgagcacatt
ctgctcgcccgtcaggttggcgttccggccctggtcgtgttcctgaacaaggtcgacatg
gtcgacgatccggagctgctggatctggtcgaaatggaagtgcgcgagctgctttcttcc
taccagttcccgggcgacgatattccgatcatcaagggttccgctctgtgcgcccttgaa
gacaagaacccggaaatcggccgtgatgcgatcctgaagctgatggaagcggtggatgcc
tacatcccgcagccggagcgtccgctggaccgtccgttcctgatgccgatcgaagacgtg
ttctcgatctccggccgtggcaccgtggtgaccggtcgtatcgagcgcggtgaagtcaag
gttggtgacgaagtcgaaatcgtcggcctgaaggcgacctccaagacgaccgtgaccggc
gttgaaatgttccgcaagctgctcgatcgcggtgaagctggcgacaacatcggtgcgctg
ctgcgtggcaccaagcgtgaagacgtcgagcgtggtcaggttctggccaagccgggctcc
atcaccccgcatacgaagttcgccgctgaggcgtacatcctcacgaaagaagagggtggc
cgtcatacgccgttcttcaccaattaccgtccgcagttctacttccgcacgaccgacgtc
actggcgttgtgagcctgccggaaggcacggaaatggtgatgccgggcgacaacgtgtcc
atgcaggttgagctgattgcgccgatcgcgatggatgaaggtctgcgttttgctattcgt
gaaggcggccgcaccgttggtgcaggcgtcgtcgcgaagatttcgcagtaa

DBGET integrated database retrieval system