KEGG   Immundisolibacter cernigliae: PG2T_13255Help
Entry
PG2T_13255        CDS       T04454                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
gbi  Immundisolibacter cernigliae
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gbi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PG2T_13255
   00620 Pyruvate metabolism
    PG2T_13255
   00630 Glyoxylate and dicarboxylate metabolism
    PG2T_13255
  Energy metabolism
   00680 Methane metabolism
    PG2T_13255
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PG2T_13255
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     PG2T_13255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2791901..2792878
Genome map
AA seq 325 aa AA seqDB search
MNKPVRIAVTGCAGNIGYALLFRIAAGDMLGPDQPVILHLLEVTPALKALEGVSMELRDC
AFPLLADIVATDDPAVGFKDADYAILVGARPRGPGMERKDLLEANGAIFTVQGKALNDHA
SRGVKVLVVGNPANTNALIAMRSAPDLDPRQFTAMMRLDHNRAISQLAAKTGSTVPAIRR
MTVWGNHSSTQYPDISHTLVDGRPAPELVDQAWLETDFIPTVQQRGAAIIAARGASSAAS
AASAAIDHMRTWALGTADGDWVSMGIPSDGSYGIPEGIIYSYPVTCRDGRYEIVQNLPVS
AFSRARMDATARELLEEREAVQHLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagcccgtccgcatcgctgtcaccggctgcgccggcaatatcggctacgcactg
ctgttccgcatcgccgccggcgacatgctcggccccgaccagccggtcatcctgcacctg
ctggaagtcacgccggccctgaaggcgctcgaaggcgtgagcatggaactgcgcgactgc
gcgttcccgctgctggccgatatcgtggccaccgacgatccggcggtcggcttcaaggat
gccgactacgccatcctggtcggtgcccgcccgcgcggtccgggcatggagcgcaaggac
ctgctggaggccaacggcgccatcttcaccgtgcagggcaaggcgctgaacgaccacgcc
agccgcggcgtgaaggtgctggtggtcggcaacccggccaacaccaacgccctgatcgcc
atgcgcagcgcaccggacctggacccgcgccagttcacggccatgatgcgcctggaccac
aaccgtgccatcagccagctggctgccaaaaccggctcgacggtgccggccatccgccgc
atgaccgtgtggggtaaccactcttccacgcagtacccggatatttcgcacacgctggtc
gatggccgtccggcgccggaactggtcgatcaggcctggcttgagaccgacttcatcccc
accgtgcagcagcgcggcgccgccatcatcgccgcccgcggcgcgtcgagcgccgcctcg
gcggcgtcggcagccatcgatcacatgcgcacctgggcgctgggcaccgccgacggcgac
tgggtcagcatgggcattcccagcgacggcagctacggcatcccggagggcatcatctat
tcctatccggtgacctgccgcgacgggcgctacgagatcgtgcagaacctccccgtcagc
gccttcagccgcgcccgcatggatgccaccgcccgggagctgctggaagaacgtgaggcc
gtccagcacctgctgtga

DBGET integrated database retrieval system