KEGG   Geobacter bemidjiensis: Gbem_3820Help
Entry
Gbem_3820         CDS       T00749                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00500  Starch and sucrose metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbem_3820
Enzymes [BR:gbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Gbem_3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ACH40812
JGI: Gbem3820
UniProt: B5EEM6
LinkDB All DBs
Position
4360029..4362581
Genome map
AA seq 850 aa AA seqDB search
MNLSSTLHRFTVVPSLPKELAGLQRIAYNLWWSWEPEAIGLFKRLDPELWRLTRHNPLEV
LGSLQQATFESLMADEGFMSHLSQVEERLTEYLSSHTWYERHGNSGARIAYFSMEFGLHE
SLPIYSGGLGILAGDHLKSASDLGLPLVGVGLLYRQGYFRQYLNLEGWQQEIYPENDFYN
LPLHQEKDRDGKPVAFSLEYPGRNVRVQVWRVQVGRVNLYLLDTNLEENAPADREITTRL
YGGDQELRIRQEILLGIGGIRALRLLGAEPNVCHMNEGHAAFLALERIRSLMEQRQLTFR
EAMEAVRGGNVFTTHTPVEAGIDHFPPDLLDQYMGHYYRNLGLSREQFMALGMQNHGRSN
ESFCMAVLAMKLSLHSNGVSELHGEVSRRMWADVWPDLPEEQLPLTYVTNGVHQKSWLSE
EMTGLLIRFLGTRWLEQSADQLWRRVSRIPDAELWRTHRRGTEQLVDYARRSLRAQLEKL
DASAKEIDAAGDVLDPEILTIGFARRFATYKRGTLLLHDKERLFRILNHPERPVQIVFAG
KAHPADHQGKELIRQIVQLSQQPEFRRRIVFLEDYDISVARRLVQGVDIWLNTPLRPLEA
SGTSGMKVAFNGGLNLSILDGWWCEGYRGNNGWAIGRGEVYDDLAYQNQVESRAIYDLLE
KEIVPLFYNRGNDGIPRGWTTFMKSSMQTLCPVFSTDRMVQEYARRCYLPAFEHWERLNR
DDLRLAVELARWKERLHGMWGELSIVAVHAEIQKEVMVGEMLPISVQITPGRIPLSEIAV
EVYFGVLDSRGAIIGGEIVPLTPVADPEKAGHFGGELECRFCGRHGFMLRVMPRHPELGT
VYDPGLILWG
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgagctcaacgctgcacagatttaccgtcgtcccctcgcttcccaaggagctt
gccgggctgcagcgcatcgcctacaacctctggtggagctgggaacccgaagccatcggc
cttttcaaacgactggaccccgaactctggcgcctgacgcgccacaaccccctcgaggtg
ctgggaagcctgcagcaggcgaccttcgagagcctcatggcggacgaggggttcatgtcc
cacctctcgcaggtagaggaacgccttaccgaatacctctcctcccacacctggtatgag
cggcacggcaactccggcgcccgcatcgcctacttctccatggaattcggcctgcacgag
tcgctccccatctactccggggggctcggcatcctcgcgggcgaccacctcaaatccgcc
agcgatttagggctccctctggtcggtgtcgggcttttgtaccgccaggggtacttccgc
cagtacctgaacctggaagggtggcagcaggaaatctaccccgaaaacgacttctacaac
ctcccgctgcaccaggagaaggacagggatggaaagcccgtggcgttctccctggagtac
ccggggagaaacgtgcgggtgcaggtctggcgggtgcaggtaggccgcgtcaacctctac
cttcttgacacgaacctcgaggagaatgcccccgccgaccgtgaaattaccaccaggctc
tacggcggcgaccaggagttgcggatcaggcaggaaatcctgctcggcatcggcggcatc
cgggcgctgaggcttttgggggccgagcccaacgtctgccacatgaacgaggggcacgcc
gccttcctggcgctggagcggatccgctccctgatggagcagcgccagctcaccttccgg
gaggcgatggaggcggtgagaggcggcaacgtcttcaccacccacacgccggttgaggcc
gggatcgaccatttcccccccgatctactcgaccagtacatggggcattactacagaaac
ctggggctttcccgcgagcagttcatggccctggggatgcagaaccacggcaggagcaac
gaaagcttctgcatggcggtgctcgccatgaagctctcgctccactcaaacggggtaagc
gaactgcacggggaggtgtcgcgcaggatgtgggcggacgtctggccggacctccccgag
gaacagctgccgcttacctacgtcaccaacggggtgcaccagaagagctggctctcggag
gagatgaccggcctgttgatccggttcctcggcaccaggtggttggaacaaagcgccgat
cagctctggcgcagggtctcgcgcatcccggacgcggagctttggcgcacgcaccggcgc
ggcaccgagcagctggtcgactacgcccgccgcagcttgagggcgcagctggagaagctc
gacgcctccgccaaggagatcgacgcggcaggcgacgtcctggacccggagatactcacc
atcggcttcgcgcgccgcttcgccacctacaagcgcgggacgctcctgttgcacgacaag
gagcggctcttcaggatactgaaccaccccgagcggccggtgcagatcgtattcgccggg
aaggcacaccccgccgaccaccagggaaaggagctgatccgccagatcgtgcagctgtcg
cagcagcccgagttccggcgccgcatcgtctttttggaggattacgacatctcggtggcc
cggcgcctggtgcagggggtggacatctggctcaacacgccgctcaggcccctggaggcc
agcggcaccagcgggatgaaggtcgccttcaacggcggcctcaacctgagcatcctggac
ggctggtggtgcgaggggtaccgcgggaacaacggctgggccatagggcgcggcgaggtg
tacgacgacctggcctaccagaaccaggtggagagccgcgccatctacgaccttctggag
aaggagatcgtgccccttttctacaaccgggggaacgacggcatcccgcgcggctggacc
accttcatgaagagctccatgcagacgctctgcccggtgttcagcacggaccggatggtg
caggagtacgcaaggcgctgctaccttcccgccttcgaacactgggagcggctgaaccgc
gacgacctgcggcttgcggtggagctggcgcgctggaaggagcggctgcacggcatgtgg
ggggagctttccatcgtggcggtccacgccgagatccagaaggaggtgatggtgggggag
atgctacccatctcggtgcagatcacgccggggcggatcccgctttccgagatcgcggtg
gaggtctatttcggggtgctcgattcccgcggcgccatcatcgggggggagatcgtgccg
cttacgccggtggcagacccggaaaaggcggggcacttcggcggcgaactggagtgccgc
ttctgcgggcggcacggcttcatgctgcgggtaatgcccaggcacccggagcttgggacc
gtgtacgatccggggctgatactctggggttag

DBGET integrated database retrieval system