KEGG   Gordonia bronchialis: Gbro_4074Help
Entry
Gbro_4074         CDS       T01102                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00250  Alanine, aspartate and glutamate metabolism
gbr00410  beta-Alanine metabolism
gbr00640  Propanoate metabolism
gbr00650  Butanoate metabolism
gbr01100  Metabolic pathways
gbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Gbro_4074
   00650 Butanoate metabolism
    Gbro_4074
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbro_4074
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gbro_4074
Enzymes [BR:gbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Gbro_4074
Amino acid related enzymes [BR:gbr01007]
 Aminotransferase (transaminase)
  Class III
   Gbro_4074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACY23240
UniProt: D0L4L5
LinkDB All DBs
Position
4372694..4374025
Genome map
AA seq 443 aa AA seqDB search
MTAGLREPNPRVTDTAPSHRQTASLSPLLKQATPVVVDHALGSWIHGTDGNDYLDFTTGI
GVTSTGHCHPRVVAAAQAQCAKVIHAQYTTVMHPPLLELTERLGGVLPTGLDSVFYANSG
SEAVEAAIRLARMATARPNIIVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMGGVHMAPF
PYAFRYGWDTDTAVDFALRELDYLLQSRVAPNDTAAFLIEPVLGDGGYLPTPPRFLAGLR
ERADAHGILLILDEVQAGFGRTGRFWGHQHADGLIPDILITAKGLASGFPISAIAAPAEI
MSKAWPGSQGGTYGGNAVAAAAAIATLDVIEDEGLVENARIRGEQMLDGLRTVTAPFAQI
GDVRGLGLMAGIEFVTTDATGVRTPDAAAALAVQQATTTHGLLTLTCGPAGNVVRLIPAL
VVTADEIDLGVSRFAAALATVLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccggcctccgcgaaccgaatccgcgtgtcaccgacaccgcacccagccaccgc
cagaccgcatcgctgagtccgctgctcaaacaggcgacgccggtggtcgtcgaccatgcg
ctgggctcctggatccacggcaccgacggcaacgattacctcgacttcaccaccgggatc
ggcgtcaccagcaccgggcactgtcacccacgggtggttgcggcggcacaagcccagtgc
gccaaagtgattcacgcgcagtacacgacggtcatgcatccgccgctgctcgaactcacc
gaacgcctcggtggcgtcctgcccacgggactcgactcggtgttctacgccaactccggc
tccgaggcggtcgaggccgcgatccgtctcgcgcggatggcaaccgcccggcccaacatc
atcgtcttccagggcggattccacggccgcacggtcgccgcggcaagcctcaccaccgcc
ggcacccgcttctcggccggcttctcaccgctgatgggcggtgtgcacatggccccgttc
ccctacgccttccggtacggctgggacaccgataccgcagtcgacttcgcgctacgcgag
ctcgattacctcctgcagtcgcgcgtcgcccccaacgacaccgcggccttcctcatcgaa
cccgtcctcggcgacggcggctacctgcccaccccgccgcgcttcctcgccggcctccgt
gagcgcgccgacgcccacggcatcctgctgatcctcgacgaggtgcaggccggtttcgga
cgcaccggccgcttctggggtcatcagcacgccgacggcctgatccccgacatcctcatc
accgcaaagggactcgcctccggcttccccatctccgcgatcgccgcgcccgccgagatc
atgagcaaggcgtggccgggttcacagggcggcacctacggcggtaatgcggtggccgcc
gccgcggcgatcgccaccctcgacgtcatcgaggacgagggactcgtcgagaacgcccgc
atccgcggggagcagatgctcgacggtttacggacggtcacagcacctttcgcccagatc
ggcgacgtccgcggcctgggcctgatggccgggatcgagttcgtcaccaccgacgcgacc
ggcgtccggacacccgacgccgccgcggcgctggccgtccagcaggccaccaccacacac
ggcctgctgaccctgacctgcgggccggccggcaatgtcgtccgcctgatcccggcactc
gtggtcaccgccgacgaaatcgacctgggcgtctcacgtttcgcagccgcactcgcgaca
gtcctcggctag

DBGET integrated database retrieval system