KEGG   Geobacillus sp. C56-T3: GC56T3_0104Help
Entry
GC56T3_0104       CDS       T01245                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gct  Geobacillus sp. C56-T3
Brite
Translation factors [BR:gct03012]
 Eukaryotic Type
  Elongation factors
   GC56T3_0104
 Prokaryotic Type
   GC56T3_0104
Mitochondrial biogenesis [BR:gct03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GC56T3_0104
Exosome [BR:gct04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GC56T3_0104
  Exosomal proteins of breast cancer cells
   GC56T3_0104
  Exosomal proteins of colorectal cancer cells
   GC56T3_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
128522..129709
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatttgagcgcacgaaaccgcacgtcaacattggcacgatcggccac
gttgaccacgggaaaacgacgttgacagctgcgatcacgacggttttggcgaaacaaggc
aaagccgaagcaaaagcgtacgaccaaatcgacgctgctccggaagagcgtgaacgcggg
attacgatttcgacggcgcacgtcgagtatgaaacagatgctcgccactatgcgcacgtt
gactgcccgggccacgctgactacgtcaaaaacatgatcacgggcgcggcgcaaatggac
ggcgcgatccttgttgtatcggcggctgacggtccgatgccgcaaacgcgcgaacacatt
cttctctcccgccaagtcggtgttccgtacatcgttgtattcttgaacaaatgcgacatg
gtggacgacgaagaattgcttgaacttgttgaaatggaagttcgcgatcttctctctgaa
tacgacttcccaggcgatgaagtgccggtcatcaaaggttcggcattaaaagcgcttgaa
ggcgacccgcaatgggaagaaaaaatcattgaactgatgaatgcggttgacgaatacatc
ccgacgccgcaacgtgaagtggacaaaccgtttatgatgccaatcgaggacgtcttctcg
atcacgggccgcggtacggttgcaacaggccgtgttgaacgcggtacgttgaaagttggc
gacccggttgaaatcatcggtttgtcggatgagccgaaaacgacgaccgttacgggtgta
gaaatgttccgcaaacttctcgatcaagcggaagccggcgacaacatcggtgcgcttctc
cgcggcgtatctcgtgatgaagtcgagcgcggccaagtattggcgaaacctggttcgatc
acgccgcacacgaaattcaaagcgcaagtatacgtcctgacgaaagaagaaggcggacgc
catactccgttcttctcgaactaccgtccgcaattctacttccgtacgacggacgtaacg
ggcattatcacgcttccggaaggcgtcgaaatggttatgcctggcgacaacgttgaaatg
acggtggaactgatcgccccgatcgcgatcgaagaaggtacgaaattctcgatccgcgaa
ggcggccgtacggtcggcgctggctctgtatcggaaatcatcgagtaa

DBGET integrated database retrieval system