KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI0277Help
Entry
GDI0277           CDS       T00631                                 

Gene name
puuE
Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GDI0277 (puuE)
   00650 Butanoate metabolism
    GDI0277 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GDI0277 (puuE)
   00280 Valine, leucine and isoleucine degradation
    GDI0277 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GDI0277 (puuE)
Enzymes [BR:gdi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GDI0277 (puuE)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     GDI0277 (puuE)
Amino acid related enzymes [BR:gdi01007]
 Aminotransferase (transaminase)
  Class III
   GDI0277 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(286765..288138)
Genome map
AA seq 457 aa AA seqDB search
MTGRHRGRPTRRLPRRRGVAYICRADSRQTRTGTMSSTNSDLQARREAAVPRGVASATAI
HAARAENAELWDVEGRRYIDFAGGIAVLNVGHRHPRVMEAVRRQAELFTHTAFQVAPYES
YIALAERLNGLAPFPGPAKTILFSTGAEATENAVKIARAATGRSGVVAFTGAFHGRSLLA
SALTGKVRPYKAPFGSMPAGVYHVPFPAGEVTVEDSLKALDFLFAADIDPAQVAAIIIEP
VQGEGGFRPTPAALLRALRAVCDTHGIVLIADEVQTGFARTGRLFGIELSGVAPDLVCIA
KSLGGGFPLSGVIGRAALMDAVGPGGLGGTYAGAPIACAAALAVLDVIAEEGLVERANAI
GALIRDRLEGMRGRRGLTPISAPRGPGAMIGFDILEGPDGPVRVGGAAAICARAAERGLI
LLSCGIQGETVRILVPLTAPDSLIEEGLAVIEQALAL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggacgtcaccggggacgaccgacaaggcggctcccgcgtcggcggggcgtggcc
tacatctgtcgggcggattcacgccagacgaggacaggcacgatgtcatccaccaattcc
gatcttcaggcccggcgcgaggccgcggtgccgcgcggcgtcgcatcggccaccgccatc
catgccgcgcgggcggagaatgccgagctgtgggatgtcgaggggcggcgctatatcgac
ttcgccggcggcatcgcggtgctgaatgtcggccatcgccacccccgtgtgatggaggcg
gtgcggcggcaggcggagctgttcacccacaccgcgttccaggtcgcgccgtatgaatcc
tacatcgccctggccgagcggctgaacgggctggcgccgtttcccggcccggcgaagacc
atcctgttttcgaccggggccgaggcgaccgagaacgccgtgaagatcgcccgcgcggcg
accgggcgcagcggcgtcgtggcctttaccggcgccttccacggccggtcgctgctggcg
tcggcgctgaccggcaaggtccggccgtacaaggcgccgttcggcagcatgccggcgggc
gtctatcacgtgccgttcccggccggggaggtcacggtcgaggacagcctgaaggcgctg
gatttcctgttcgcggccgatatcgatccggcgcaggtggccgccatcatcatcgagccg
gtacagggcgagggcggattccgtccgacccccgccgccctgctgcgggcgctgcgcgcg
gtctgcgatacgcacgggatcgtgctgatcgccgacgaggtgcagaccggcttcgcgcgg
accgggcggctgttcggcatcgaactgtcgggcgtggcgccggacctggtctgtatcgcg
aaatcgctgggcggcggctttccgctgtcgggcgtgatcggccgcgccgcgctgatggat
gcggtggggcccggcgggctgggcgggacctatgccggggcgccgatcgcctgcgcggcg
gcgctggcggtcctggacgtcattgccgaagaggggctggtggagcgggcgaacgcgatc
ggcgccctgatccgcgaccggctggaggggatgcgcggccggcgcggcctgacgccgatc
agcgcgccgcgcggaccgggagccatgatcggcttcgacatcctggaggggccggacggg
ccggtgcgcgtcggcggggccgccgcgatctgcgcccgcgccgccgaacgggggctgatc
ctgctgtcatgcggcatccagggcgagacggtgcgcatcctggtgccgctgacggcgccg
gacagcctgatcgaggaagggctggcggtcatcgagcaggcgctggcgctttaa

DBGET integrated database retrieval system