KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI3406Help
Entry
GDI3406           CDS       T00631                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Brite
Translation factors [BR:gdi03012]
 Eukaryotic Type
  Elongation factors
   GDI3406 (tufB)
 Prokaryotic Type
   GDI3406 (tufB)
Mitochondrial biogenesis [BR:gdi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GDI3406 (tufB)
Exosome [BR:gdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GDI3406 (tufB)
  Exosomal proteins of breast cancer cells
   GDI3406 (tufB)
  Exosomal proteins of colorectal cancer cells
   GDI3406 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(3500082..3501272)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKTLAKTGGATFKAYDQIDAAPEERARG
ITISTAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSAYQFPGDDIPIIKGSALVTLE
DGDPEVGENRVRDLMDAVDAYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVVN
VGDEIEIVGLRATQKTTVTGVEMFRKLLDRGEAGDNIGALVRGTKREDVERGQVLAKPGS
ITPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MDVELIAPIAMDEGLRFAIREGGRTVGAGVVASITA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaattcgagcggacgaagccgcactgcaatatcggcacgatcggtcac
gtcgatcatggcaagacgtcgctgaccgccgcgatcactaagacgctggcgaagaccggt
ggcgccaccttcaaggcgtacgaccagatcgacgcggcgccggaagagcgcgcccgtggc
atcacgatctcgaccgcccacgtcgagtacgagaccgcgaagcgccactacgcgcacgtc
gactgccccggtcacgccgactacgtgaagaacatgatcacgggtgccgcccagatggac
ggtgcgatcctggtcgtgtccgccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgccaggtcggcgtcccggccctggtcgtgttcctgaacaaggtcgaccag
gtcgacgatccggaactgctcgagctggtcgagatggaagtgcgcgagctgctgtccgcg
taccagttcccgggcgacgatatccccatcatcaagggttcggccctggtgacgctggaa
gacggtgacccggaagtcggcgagaaccgcgtgcgcgacctgatggatgcggtcgatgcc
tacatcccgcagccggagcgtccggtcgaccgtccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtgtcgagcgtggcgtggtgaac
gtcggtgacgaaatcgaaatcgtcggcctgcgcgcgacgcagaagacgacggtgacgggc
gtcgaaatgttccgcaagctgctggatcgcggcgaggccggcgacaacatcggcgcgctg
gtgcgtggcacgaagcgtgaggacgtcgagcgcggtcaggtcctggcgaagccgggctcc
atcaccccgcacacgaagttcaaggccgaggcctacatcctgacgaaggaagagggcggc
cgtcacacgccgttcttcaccaactatcgtccgcagttctatttccgcaccaccgacgtc
accggcgtcgtgcacctgccggaaggcacggaaatggtcatgccgggcgataacatcgcc
atggatgtcgagctgatcgctccgatcgccatggacgaaggcctgcgcttcgcgatccgc
gaaggcggccgcaccgtcggcgccggcgtggttgcttcgatcacggcctga

DBGET integrated database retrieval system