KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2239Help
Entry
Gdia_2239         CDS       T00798                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Gdia_2239
Enzymes [BR:gdj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Gdia_2239
DNA repair and recombination proteins [BR:gdj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Gdia_2239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2482664..2485234
Genome map
AA seq 856 aa AA seqDB search
MALDTYRSKRDFKATPEPEGAEAAEKPDTGAGHLFVIQKHAAHRLHYDLRLEMDGVLKSW
AVTRGPSLNPGDKRLAVQVEDHPLDYGTFEGTIPKGQYGGGTVMLWDKGTWTPLHDPVRG
LAKGHLDFELRGEKLHGRWNLVRMDGHREGTHENWLLIKAADSDARSKNDADILEERPES
VKTGRAMDDIAAGAPGKDRVGKAAAQKAVTKKAAIPKDAPQADAAATGAAPCAGAKPGPL
PSFVEPELATLVRAAPTGPQWLHEVKFDGYRLLARIEAGRVVLLTRTGLDWTARFGDQIS
AALASLPVRTALIDGELVVETAGGTSDFSALQADLSAGRTDRFIFYVFDLLHLDGYDLRD
ATLEARKGALHDLVPDDAARLRFSGHFDEAGGQVLRHACRLGLEGIVSKQRDVPYRSGRG
RDWVKSKCVARQEFVIGGYVPSTASRGAVGSLVLGVQENGRLVHVGRVGTGFTAATAADL
LRRLQPLDVPDSPFAAALTARERKGVRYVRPDCVAEVEFRAWTADGHLRHAAFLGLREDK
PAADIVREVEAPDPVSSGPSSKPVKPVSPEPAPARPARTLTHPDRSYWPDAGVTKQDLAD
YYAAIWPRMAPFITDRALALLRCPNGIAGPRFFQKNLWKGAGGHLVPLRDPEGDPGTPLI
GLRDRDGLIDLAQAAALEIHPWGASAQAWDQPDMIVMDLDPGDGVPWSMVIEAAREIRAR
LERSGLASFVKTTGGKGLHVVAPLKPGADWTAVKAFTRSMAQAMVSDSPQRYVATITKSR
RQGRILVDYLRNQRGATAVAPYSPRARPGAPVAMPLAWNELGPDIGPAHFTIGTIAARLA
VADPWAEIRDAARPLR
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggatacctatcgcagcaagcgcgatttcaaggcgacgcccgagcccgagggt
gccgaggcggcggaaaagccggataccggcgcgggccatctgttcgtcatccagaaacat
gcggcacaccgcctgcattacgacctgcggctggaaatggatggcgtgctgaagagctgg
gcggtgacgcgcggccccagcctgaacccgggcgacaagcgcctggccgtgcaggtcgag
gaccacccgctggattacggcacgttcgagggcacgatcccgaaggggcagtatggcggc
ggcacggtcatgctctgggacaagggcacgtggacgccgctgcacgatccggtccggggc
ctcgccaaggggcatctcgatttcgaactgcggggcgaaaagcttcacggacgctggaac
ctggtgcggatggacggacaccgcgagggaacgcatgagaactggctgctgatcaaggcc
gccgattccgatgcacggtcgaagaacgatgccgatatcctcgaagagcggccggaatcc
gtaaagaccggccgtgcgatggacgacatcgcggccggtgcgccagggaaggacagggtc
gggaaggcggcggcccaaaaagccgtgacgaagaaagccgcgataccgaaggacgcgccg
caggcggacgcggccgcgacaggcgccgcaccctgcgcgggggcgaagcccggcccgttg
ccatccttcgtcgagcccgaactggccaccctggtgcgcgcggcccccaccggcccgcaa
tggctgcacgaggtcaagttcgacggctaccgcctgctggcgcggatcgaagccggacgg
gtcgtgctgctgacccgcacgggcctggactggaccgcccggttcggcgaccagatcagt
gccgcgctggcgtccctgccggtgcggacggcgctgatcgacggcgaactggtggtggaa
accgcaggcgggacctcggatttttccgctctccaggccgatctcagcgccggccgcacc
gaccgcttcatcttctacgtcttcgatctgttgcatctggacggctacgacctgcgcgac
gcgacgctggaggcgcgcaagggcgcgctgcacgacctggtgccggacgatgcggcgcgg
ctgcgcttcagcggccatttcgacgaggccggggggcaggtgctgcgccatgcctgccgc
ctgggcctggagggaatcgtctccaagcagcgggacgtgccctaccggtcgggacggggc
cgggactgggtgaaatcgaaatgcgtggcgcggcaggaattcgtgatcggcggctacgtg
ccctcgaccgccagccggggggcggtcggctcgctggtccttggggtccaggaaaacggc
aggctggtccatgtcggccgggtcgggaccggcttcaccgccgcgacggcggcggacctg
ctccggcgcctgcaaccgcttgatgttcccgacagtcccttcgccgctgccctgacggcc
cgcgagcgaaagggggtgcgctatgtccgccccgattgcgtggcggaagtggaattccgc
gcctggaccgccgacggccatctgcgccacgcggcgttcctgggcctgcgcgaggacaag
ccggcggccgacatcgtccgcgaggtcgaagcgcccgaccccgtatcctccggcccttca
tccaaaccggtcaaaccggtttccccggaacccgcgcctgcccgcccggcccgcaccctg
acccatcccgaccggtcctactggccggatgccggcgtgaccaagcaggacctggccgat
tattacgccgcgatctggccgcgaatggcgcccttcatcaccgaccgcgcgctggcgctg
ttgcgctgccccaacggcatcgcggggccgcgcttcttccagaagaacttatggaagggc
gccggcggtcacctggtgccgttgcgggacccggaaggcgatcccggcacgccgctgatc
ggcctgcgcgaccgcgacgggctgatcgacctggcgcaggccgccgcgctggaaatccat
ccctggggcgcgtccgcccaggcgtgggaccagcccgacatgatcgtgatggacctcgat
cccggcgacggcgtgccctggtccatggtgatcgaggcggcgcgggaaatccgcgcgcgg
ctggaacggtccggcctcgcgtccttcgtcaagacgaccggcggcaaggggctgcatgtc
gtggcgccgctgaaacccggggccgactggacggcggtcaaggccttcacccggtccatg
gcccaggcgatggtgtcggacagcccgcagcgttacgtggccaccatcaccaaatccagg
cgccagggccgtatcctggtcgattacctgcgcaaccagcgcggcgcgaccgccgtcgcg
ccctattccccccgtgcccgccccggcgcgccggtcgcgatgccgctggcctggaacgaa
ctggggccggatatcggacccgcgcatttcaccatcgggacgatcgccgcccgactggcg
gtcgcggacccgtgggcggagatccgtgacgcggcccggccgctccgttaa

DBGET integrated database retrieval system