KEGG   Geobacillus sp. 12AMOR1: GARCT_00705Help
Entry
GARCT_00705       CDS       T03966                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GARCT_00705
  Lipid metabolism
   00071 Fatty acid degradation
    GARCT_00705
  Amino acid metabolism
   00350 Tyrosine metabolism
    GARCT_00705
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GARCT_00705
   00626 Naphthalene degradation
    GARCT_00705
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GARCT_00705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(684155..685174)
Genome map
AA seq 339 aa AA seqDB search
MKAAVVEQFKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVEEVGPGVTHLKVGDRVGIPWLYSACGHCEYCLSGQETLCEQQKNAGYSVDGGY
AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGAKPGEWVAIYGIGGLGHVA
VQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNPLKEDAAKFMKEKVGGVHAAVVTAVS
KPAFQSAYNSIRRGGACVLVGLPPEEMPIPIFDTVLNGIKIIGSIVGTRKDLQEALQFAA
EGKVKTIIEVQPLEKINEVFDRMLKGQINGRVVLTLEDK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtagtggaacaatttaaggaaccattaaaaataaaagaagtagaaaaa
ccaaccatttcatatggagaagtattagtccgcattaaagcatgcggtgtttgtcatact
gacttgcatgccgctcacggcgattggccggtaaaaccaaaacttcctttaatccctggc
catgaaggagtaggaattgttgaagaagtaggtccaggcgtaacccatttaaaagtgggc
gaccgcgttggaattccttggttatattccgcttgcggccattgtgaatattgtttaagc
ggacaagagacattatgtgagcaacaaaaaaatgcaggctactcagtcgacggaggttat
gctgaatactgcagagcggcggcagactatgtggttaaaattcctgacaacttatcattt
gaagaagctgccccaattttctgcgccggagttactacctataaagcgttaaaagtaaca
ggggcaaaaccaggagaatgggtagcaatttacggtatcggcggccttggacacgttgcc
gttcaatacgcgaaggcgatgggacttaatgtcgttgctgttgatatcggcgacgaaaaa
cttgaacttgcaaaagaacttggcgctgatcttgttgtaaaccctttgaaagaagatgca
gcgaaatttatgaaagagaaagtcggcggagttcacgcagcagtcgtaacagctgtatct
aagccagcgtttcaatctgcgtacaattctatccgcagaggcggagcttgtgtgcttgtc
ggattgccaccggaagaaatgcctattccaatttttgatacggttttaaatggaatcaaa
atcatcggttccattgtcggcacgcggaaagacctgcaagaagcgctccaattcgcagcg
gaaggtaaagtaaaaaccattattgaagtgcaacctcttgaaaaaattaatgaagtattt
gacagaatgctaaaaggtcaaattaacgggcgtgtagttttaacgttagaagataaataa

DBGET integrated database retrieval system