KEGG   Geobacillus sp. 12AMOR1: GARCT_02790Help
Entry
GARCT_02790       CDS       T03966                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00020  Citrate cycle (TCA cycle)
gea00480  Glutathione metabolism
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01120  Microbial metabolism in diverse environments
gea01130  Biosynthesis of antibiotics
gea01200  Carbon metabolism
gea01210  2-Oxocarboxylic acid metabolism
gea01230  Biosynthesis of amino acids
Module
gea_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gea_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gea00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GARCT_02790 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GARCT_02790 (icd)
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GARCT_02790 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKM20040
UniProt: A0A0G3Y027
LinkDB All DBs
Position
complement(2717601..2718872)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVQNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFPGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAQYDRIVEAEGKEAANKAMAEAEASGKIIIKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIKAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggagaaaaaattacagtccaaaatggtgtgctcaacgttccgaacaacccg
atcattccgttcatcgagggggatggaaccggcccggacatttgggcggccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggtgagaaaaaaatcgtctggaaggaa
gtgctcgctggtgaaaaagcgtacaagctgacgggcagctggcttccggatgaaacgctt
gagacgatccgcgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgttcgctcaacgtcgcgctccgccaagagctcgacctgtttgtctgcctgcgt
ccggttcgctacttcccaggcgttccgtcgccggtgaaacgcccggaagacaccgatatg
gtcattttccgcgagaacacggaagacatttacgccggcattgaatacgccaaaggaacg
ccggaagtgaaaaaagtgatcgacttcttgcaaaacgaaatgggcgtgcgcaaaatccgt
ttcccggaaacgtccggcatcggcattaagccgatttccgaacaagggacgaaacggctt
gtgcgcgcggcgatcaactatgcgatcgaacacggccgcaagtcggtgacgctcgtccat
aaagggaacattatgaagttcacggaaggcgcgtttaaaaactggggctatgagcttgcc
gaacaagaattcggcgataaagtgttcacgtgggcgcaatacgatcggatcgtcgaagcc
gagggcaaagaggcggcgaacaaagcgatggcggaagcggaagcgtccggcaaaatcatt
atcaaagatgtcatcgccgacatcttcctgcaacaaattttgacgcgtccgcgcgaattt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctggccgctcaa
gtcggcggcatcggcatcgcgccgggggccaacatcaactacgaaaccggccacgccatt
ttcgaggcgacgcacggcacggcgccgaaatacgccggtcttgacaaagtcaatccgtcg
tccgtcattctctcgggcgtcatgatgtttgagcatcttggttggaacgaagcagcgaaa
ttgatcatcaaagcgatggagaaaaccatcgccgcgaaaatcgtcacgtatgacttcgcc
cgcctgatggaaggggcaaccgaagtgaaatgttcggaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system