KEGG   Geobacillus sp. 12AMOR1: GARCT_02964Help
Entry
GARCT_02964       CDS       T03966                                 

Gene name
yojM
Definition
(GenBank) Superoxide dismutase-like protein YojM precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gea  Geobacillus sp. 12AMOR1
Brite
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GARCT_02964 (yojM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu AHSA1 LPAM_2
Motif
Other DBs
NCBI-ProteinID: AKM20193
UniProt: A0A0G3Y2L7
LinkDB All DBs
Position
complement(2880841..2881365)
Genome map
AA seq 174 aa AA seqDB search
MLRGSYAIMSAVLLVLSGCGQDEGTSRTVEMINADGDRIGTVELTEQAEGVRLKLDLEGL
PPGEHAIHIHEKGSCQPPDFQSAGGHYNPDGKKHGLLHPEGAHAGDLPNIIVKEDGTVNV
ELTAPNVTLREGEKGTLLTKDGTSIVIHAKKDDGMTQPAGDAGGRIACGEIKSS
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgtggatcatatgcgatcatgtccgccgtgctgctcgtgttgtccggctgcggg
caagatgaaggaacgagccggacggtggagatgatcaatgcggacggcgatcggatcggt
acggtggaattgacggagcaagccgaaggagtgcggttgaagctcgatttggaagggctc
ccgccgggggagcacgccattcatattcatgaaaaaggaagttgccagccgcctgatttt
cagtcggcgggcgggcattacaacccggacgggaaaaagcacggccttctccatccggaa
ggggcgcacgccggcgatttgccgaacatcattgtgaaggaggacggcacggtcaacgtc
gagctgacggcgccgaatgtgacgctccgggaaggggaaaaagggacgctcttgacgaaa
gacggaacatcgatcgtcattcacgccaagaaagacgacggcatgacccagccggccggc
gacgccggcgggcggatcgcctgtggggaaatcaagtcgtcatga

DBGET integrated database retrieval system