KEGG   Geitlerinema sp. PCC 7407: GEI7407_0751Help
Entry
GEI7407_0751      CDS       T02366                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GEI7407_0751
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    GEI7407_0751
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    GEI7407_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
911509..912348
Genome map
AA seq 279 aa AA seqDB search
MAVNLEARKPAPLLPPAVRKFLKQNSQRVFPPIIAIALFLFIWQILCSGPQSNLPSPTQT
LSETWELIIDPFFDNGGTDKGLFWQIFASLQRVAIGFSLSAIVGIGLGILIGTNRFMYNA
LDPLFQVLRTVPPLAWLPISLAAFRDSNPSAIFVIFITAIWPIIINTTVGVQQIPQDYRN
VARVLQLSRIEYFFNILFPSTVPYIFTGLKIGVGLSWLAIVAAEMLVGGVGIGFFIWDAW
NSSRLSEIILALIYVGVVGLLLDRLVSFIASLVVPEGQR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaacctcgaggctcgtaagcctgcacccctactgccgcccgccgttcgcaag
tttctcaagcagaactcccagcgcgtatttccgccgatcattgcgatcgccctttttctg
ttcatttggcaaatcctgtgcagcggcccccagtccaacctgcccagccccacccagacc
ctcagcgaaacctgggaactgattattgatcccttctttgacaatggcggcaccgacaaa
ggcctgttctggcagatcttcgccagcttacagcgggtggccatcggcttttctctgtcc
gcgatcgtgggcatcggtctgggtatcttgatcgggaccaaccgcttcatgtataacgcc
ctggacccgctgttccaggtgctgcggacggtgccgcccctggcctggctgcccatttcc
ctggctgctttccgcgacagcaacccctccgccatcttcgtcatcttcatcacggcgatc
tggcccatcatcatcaacaccacggtgggcgttcagcaaatcccccaggactatcgcaac
gtggcccgggtgctccagctgtcccgcattgagtactttttcaacatcctgtttccctcg
accgttccctacatctttaccggcctcaagattggcgtcggcctgtcctggctggcgatc
gtggcggcggagatgctggtgggcggtgtaggcatcggcttctttatctgggacgcctgg
aacagctcgcgcctgagcgaaatcatcctggccctgatttatgttggcgtcgtgggactg
ctgctcgatcggctggtaagcttcattgccagcctggtggtccccgaaggccagcgctaa

DBGET integrated database retrieval system