KEGG   Geobacillus sp. JS12: A0V43_12480Help
Entry
A0V43_12480       CDS       T04412                                 

Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gej  Geobacillus sp. JS12
Brite
Enzymes [BR:gej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     A0V43_12480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2543297..2544115
Genome map
AA seq 272 aa AA seqDB search
MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLRFEIALRDRIVRAAGE
LAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDIFVHSERYAFECATAIV
IVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEHFLPGDCLYFKNPEFDPL
TPQWQGENTIYLGDGLFYGHGIGIQTADGIIAALNRKRKQGATKSAYLLPDITQVDFAYL
SQFARRLDEFRLPIRRSSLIVGTLGSATFLHR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcgtgttgtcaccaatcaactttgacgtttcgagttcgttttcgcttccggcc
agcgaacaacgaatcttagatgcccttgtttcctcgcctaagttgtatacgtatgcaaat
aaacaccagcttcgatttgaaatcgccttgcgcgaccgcattgttcgggcggcgggcgag
ttggcgaaaagccgggcgcggtttgccattttccgtttttcgcgctgcaacagcgatttc
tggacgcgggacgagcgcggcggcttccgtcttcgtccagatgtcacggcttccgaagcg
attcaggacatttttgtccatagcgagcgatacgcgtttgaatgcgcgaccgcgatcgtc
atcgtgttctacaaagccgtgcttgacgtaatcgatccagcggcattcaaccggctgttt
gcggatttgctgctgtatgactggcataccgaccgggatcttggcattcaaacaaaaaaa
gatgaacactttctccccggagattgcctctatttcaaaaacccggaattcgatccgctg
acgccgcaatggcaaggggaaaatacgatctacttgggcgacgggttgttttacggacac
ggcatcggcattcagacggcagacggcattatcgccgccctcaatcgaaagcgaaagcag
ggggcgacgaaatcggcttacctgcttcccgatatcacacaagtcgatttcgcttatttg
tcccaattcgctcgccgcctcgatgaattccgcctgccgatccgccgctcttcgttgatc
gtcggaacgttagggtccgctacgttcttgcaccgttag

DBGET integrated database retrieval system