KEGG   Geobacillus sp. JS12: A0V43_14580Help
Entry
A0V43_14580       CDS       T04412                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00240  Pyrimidine metabolism
gej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gej00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A0V43_14580
Enzymes [BR:gej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A0V43_14580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AMQ21899
UniProt: A0A142D4E7
LinkDB All DBs
Position
complement(2973350..2973973)
Genome map
AA seq 207 aa AA seqDB search
MYVMTQSGWLEVICGCMFSGKSEELIRRVRRAQFAKQEVKVFKPTIDNRYSEDAVVSHNG
NSVIAIPVATPAEMFRYISAATDVVAIDEVQFFSDDIIDVVQTLADGGCRVIAAGLDQDF
RGEPFGPVPALMAIAESVTKLQAVCTVCGSPASRTQRLINGAPASYDDPVILVGASEAYE
PRCRHHHEVPGKPKKRYNRPLAGHTGE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgatgacgcagtccggctggcttgaggtcatttgtggatgcatgttttccggc
aaatcagaagaattgattcgccgcgtccgccgcgctcagtttgccaagcaggaagtgaaa
gtgttcaaaccgacgatcgacaatcgttatagcgaagacgcagtcgtgtcgcacaacggc
aattcggtgatcgccattccggtcgcgacgccggcggaaatgttccgctacatttccgcc
gccaccgacgtcgtcgccatcgatgaagtacagtttttttccgacgacatcatcgatgtg
gtgcaaacgctcgctgatggaggctgccgcgtcatcgccgcggggctcgaccaagatttt
cgcggtgaaccgtttggccccgtgccggcgctgatggcgatcgcggagtcggtgacgaag
ctgcaggcggtttgcacggtatgcggttccccagccagccggacgcagcggctcattaac
ggtgcgcccgcctcttatgacgatccggtgattctcgtcggcgccagcgaggcgtacgag
cctcgctgccgccatcaccatgaagtgcctggcaaaccgaaaaagcgatacaaccgcccg
cttgctggacatacgggtgagtga

DBGET integrated database retrieval system