KEGG   Geminocystis sp. NIES-3709: GM3709_1338Help
Entry
GM3709_1338       CDS       T04142                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gen  Geminocystis sp. NIES-3709
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM3709_1338
   00020 Citrate cycle (TCA cycle)
    GM3709_1338
   00620 Pyruvate metabolism
    GM3709_1338
Enzymes [BR:gen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GM3709_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1508403..1509635
Genome map
AA seq 410 aa AA seqDB search
MTEGKIVSWEKAPGDRIEKGETVVVVESDKADMDVESFYSGYLATILVQAGEEAPVGQAI
AYIAETEAEIETAKQKASQGQTVTTPAPTPEVKPIVEPQPIGVTTTVATPAKSNGRIIVS
PRAKKLAKELKVDLSNIIGTGPNGRIIAEDVEKAVGKTPQMPPVVPVSIPTKVQPTITPT
PVVNNLAGETVPFNTLQQAVIRNMMASLQVPTFQVSYTITTDALDTLYRKIKSKGVTMTA
LLAKAVAMTLQKHPVVNAGFTDKGIKYNEGINIAVAVAMPDGGLITPVIKNADQLDIYSL
ARNWQDLVNRARAKQLQPDEYTTGTFTLSNLGMFGVNDFTAILPPGTGAILAIGGVRPTV
VANKDGLFGVKNQMTVNITCDHRTIYGADAAGFLQDLAKLIENDSHSLTL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggggaaaattgtttcatgggagaaagcacccggagatagaattgaaaaagga
gaaaccgttgttgtcgtggagtcagacaaagcggatatggatgtagaatccttctattct
ggttatttagccactattttagtacaagcaggagaagaagcccccgttggtcaggcgatc
gcttacattgcagagacagaagcagaaatcgaaacagcaaaacaaaaagctagtcaaggg
caaaccgttaccactcccgcaccaactccagaagtaaaacccatagttgaacctcaacca
ataggagtaaccaccaccgtagcaacccctgcaaaaagtaacggtagaataattgtctct
cctagagcgaaaaaactagcaaaagaattaaaagtcgatttaagtaatattatcggtact
ggacctaatgggcgtattattgcggaagatgtggaaaaagccgttggcaaaacgcctcaa
atgccacctgttgtccctgtcagtattcctacaaaggttcaacccactattacccctact
cctgttgttaataatttagcaggagaaacagttcctttcaacactttacaacaagccgtt
attcgcaacatgatggctagtttacaagtacccactttccaagttagctacactatcacc
acagatgcgttagatactctttatcgcaaaattaaatcaaaaggtgtcactatgacggca
ttacttgccaaagcagtggcgatgacgttacaaaaacatcccgtcgttaacgcaggtttt
acggataaaggtattaaatataacgaaggtataaatattgccgtagcggtggctatgcct
gatggtggtttaattactcctgttattaaaaatgctgatcaattagatatttactcctta
gcgcgtaactggcaagacttggttaatcgagcgcgtgccaaacaattacaacccgatgaa
tataccacaggtacatttaccctttctaatttaggaatgtttggagtaaatgactttacc
gctattttacctcccggcactggggctattttggcgatcggtggtgtccgtcctacagtt
gtagctaataaagacggtttatttggtgtaaaaaatcaaatgactgtcaatataacttgt
gatcatcgtactatttatggtgcagatgcggcaggatttttacaggatttagcaaaatta
atcgaaaacgatagtcattctctaactctttag

DBGET integrated database retrieval system