KEGG   Geosporobacter ferrireducens: Gferi_12280Help
Entry
Gferi_12280       CDS       T04493                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe00010  Glycolysis / Gluconeogenesis
gfe00020  Citrate cycle (TCA cycle)
gfe00620  Pyruvate metabolism
gfe00633  Nitrotoluene degradation
gfe00640  Propanoate metabolism
gfe00650  Butanoate metabolism
gfe00680  Methane metabolism
gfe01100  Metabolic pathways
gfe01120  Microbial metabolism in diverse environments
gfe01130  Biosynthesis of antibiotics
gfe01200  Carbon metabolism
Module
gfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gferi_12280 (porA)
   00020 Citrate cycle (TCA cycle)
    Gferi_12280 (porA)
   00620 Pyruvate metabolism
    Gferi_12280 (porA)
   00640 Propanoate metabolism
    Gferi_12280 (porA)
   00650 Butanoate metabolism
    Gferi_12280 (porA)
  Energy metabolism
   00680 Methane metabolism
    Gferi_12280 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Gferi_12280 (porA)
Enzymes [BR:gfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Gferi_12280 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AOT70301
UniProt: A0A1D8GHC2
LinkDB All DBs
Position
complement(2620693..2621874)
Genome map
AA seq 393 aa AA seqDB search
MAIRERLSGNEAVATAMKQINPDVVAAFPITPSTEVPQYFSTYVANGEVDTEFVAVESEH
SAMSACIGAAAAGARVMTATSANGMGLMWEMLYIASADKLPIVMPLINRAMSGPLNIHND
HSDAMGARDSGWIQLFSEDNQEAYDNTIMAVRIGEHKDVRLPVMVCLDGFIISHSVENIE
LLETDKVRNFVGEPMAPFYLLDSENPVAMGPLDLPAHYFEHKREQAQSMFNAKTVIAEVF
ADFEKLSGRKYSYFEEYKLDDAEVAVVVLGSTAGTAKTVVDELRAQGMKVGLLKLRVFRP
FPAAELAEALKHLKAVAVMDKAESFSAAGGPIFMDVRSALYDLEARPKITSYVYGLGGRD
VRTTDIEKVYNELKEVAATGVVSSPYNYLGVKE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcgagaaagattaagtggaaacgaagccgtagcaacggcgatgaagcaaata
aatcctgatgtagttgctgctttcccaattacaccatccactgaggtgcctcagtacttc
tcaacatatgttgcgaacggagaagtggatacggagtttgtagcagttgaaagtgagcat
agtgccatgagtgcctgtatcggtgcggctgcagcgggtgctagggttatgacagcaact
tcagcaaacggtatgggattgatgtgggagatgttatacattgcatctgccgataaactt
ccaatcgttatgcctttgatcaatagagcaatgtctggaccattaaatatccataatgat
cacagtgacgctatgggcgctagagattctgggtggatccaattgttctcagaagacaac
caagaagcctatgacaatacgattatggctgttcggattggagagcataaagatgttaga
ctgcctgtaatggtatgtttagatggattcattatcagccactctgttgaaaatatagag
cttttagagacagataaagttagaaacttcgtaggagaaccaatggcaccattctatcta
ttggatagtgagaatcctgtagccatgggaccactggatttacccgctcattactttgaa
cacaagagagagcaagcacagtcaatgtttaacgcaaagactgtaatcgctgaagttttc
gcagattttgaaaagctttcaggaagaaaatatagctattttgaagaatataagttggac
gatgcagaggttgctgttgtagtattgggatctactgcaggtacggcgaaaacagttgta
gatgaactaagagcgcaaggaatgaaagttggtttattgaagctccgtgtattcagacca
ttcccggcagcagagctagcagaagctttaaagcatctaaaagctgttgcggtaatggac
aaggctgaatccttctcagcagctggcggtccgatcttcatggatgtacgttctgcttta
tacgatttagaggcaaggccgaagattactagctatgtatacggtctaggcggaagagat
gtaagaacaacagatattgaaaaagtatacaatgagctcaaggaagttgctgcaacaggt
gttgtttcttcaccgtacaactaccttggcgtaaaagagtag

DBGET integrated database retrieval system