KEGG   Geosporobacter ferrireducens: Gferi_20950Help
Entry
Gferi_20950       CDS       T04493                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gfe  Geosporobacter ferrireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gferi_20950
   00030 Pentose phosphate pathway
    Gferi_20950
   00051 Fructose and mannose metabolism
    Gferi_20950
   00052 Galactose metabolism
    Gferi_20950
  Energy metabolism
   00680 Methane metabolism
    Gferi_20950
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Gferi_20950
Enzymes [BR:gfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gferi_20950
Protein phosphatases and associated proteins [BR:gfe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gferi_20950
Messenger RNA biogenesis [BR:gfe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Gferi_20950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4473109..4474071
Genome map
AA seq 320 aa AA seqDB search
MKKIGVLTSGGDSPGMNAAIRAVVRAAIYNDLKVVGIKRGYEGLINGDIENMSLSSVADI
IHRGGTMLRTARSEDFKTEKGFSKALNVINIFGIDGIVVIGGDGSFRGAEKLSQAGISTI
GLPGTIDNDLAYTDYTIGFDTAINTVLNAISNIRDTSTSHGRANIIEVMGRHCGDIALYA
GLAGGAESIIVPEEEFSIDEICKRLIQGRNRGKLHSIILLAEGVVKNSYEVASEIEEKTG
IETKLTILGHIQRGGSPTAFDRILASRMAGKAVELILDNKSSRVIGIKGNEIIDMDISEA
LTIEKKLNQDIYRLAKVLSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcggggttcttaccagtggtggggattcgccgggaatgaatgctgcaatt
cgggcagtcgttcgagcagctatttataatgatctaaaagttgtagggatcaaaagaggc
tatgaaggtttgataaatggagacatagaaaatatgagcctatcttctgtagctgatatc
attcaccggggcggaacaatgctgcgtaccgcacgtagcgaagactttaagacagaaaag
ggttttagcaaagcattaaatgtaatcaatatttttggaattgatggtattgtagtcata
ggaggggatggatcctttagaggagcagaaaaactgagtcaagcaggaatttcaaccatc
ggtttaccgggaaccatagacaatgatctggcatacaccgattacacaattggatttgat
acggccattaataccgtattgaatgccatcagcaatataagggatacttctacttctcat
ggaagggcaaacattatcgaggtaatgggaaggcactgtggggatattgcactatacgcg
ggactggccggcggtgcagagagcattatcgtaccggaagaagagttctcaatcgacgag
atctgtaagcgactcatacaaggtcgaaatagaggaaaactacatagtattattcttctt
gcagaaggtgtcgtgaaaaattcctatgaggtagccagtgaaattgaggagaaaaccggt
atagaaacgaaactaacaatattaggacatattcagagaggtggaagtccaactgctttt
gacagaatactagctagtcgaatggccggaaaagcagtagaactaattctagataataag
agcagcagagtaattgggataaaaggaaatgaaatcatcgacatggatatatcagaagcg
ttgacaatcgaaaagaagctaaatcaagatatatatcgattagctaaagtactatcaata
taa

DBGET integrated database retrieval system