KEGG   Gramella flava: GRFL_1804Help
Entry
GRFL_1804         CDS       T04640                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
Organism
gfl  Gramella flava
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2047149..2047757
Genome map
AA seq 202 aa AA seqDB search
MAKDFLKKYREKRDFDISAEPFGDEVHKKDEDKQIFVIQMHNATNLHFDFRLLVDGVLKS
WAVPKGPSTDPHVKRLAIRTEDHPLNYADFEGVIPEGQYGGGTVMVWDAGTYENDKTNDQ
GEKISMAEQLREGHSTFILNGKKLRGGYTLIRTRKGEKEQWILKKVDDDQADARRNPVST
EKKSVLTGRTMKEIQKDAEKNG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggattttctgaagaaataccgggaaaagcgcgattttgatatttccgcggaa
ccgttcggcgatgaggtgcacaaaaaggacgaagacaaacagatttttgtcattcagatg
cataacgcgaccaacctgcacttcgatttcaggcttttagtagacggggtgctgaaaagc
tgggcagtgcctaaaggcccttccacagatcctcatgtaaagcgactggccatcaggacg
gaggatcacccgttgaattatgccgattttgagggagtaatcccggaaggccagtatggc
gggggaacggtcatggtctgggatgcgggtacttacgagaatgataaaaccaacgatcag
ggcgagaagatcagtatggccgaacaattgagggaagggcacagtacttttattttgaat
ggaaagaagctgcggggcggatatacgcttattcgtacgcggaaaggggaaaaggagcaa
tggatcctgaaaaaagtggatgatgaccaggctgatgccaggagaaacccggtgagcacc
gagaagaaatcggttttaacaggaagaacgatgaaagaaattcaaaaggacgcggaaaaa
aatggctga

DBGET integrated database retrieval system