KEGG   Gramella flava: GRFL_3177Help
Entry
GRFL_3177         CDS       T04640                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gfl  Gramella flava
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gfl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GRFL_3177
  Energy metabolism
   00680 Methane metabolism
    GRFL_3177
Enzymes [BR:gfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GRFL_3177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3514753..3517326
Genome map
AA seq 857 aa AA seqDB search
MNREPRLDRFNDNVLAKYQVYNSIFLTLPYDDIKKTGALLPLFLEICESGFEQNKNPSEI
VERFFQKYGEDPTEEEKVALLFRFIQYIERQVVLFDAIEDASFPIVNNMDGRGTLRSVKE
EAEATQKLDELKKFLKRFKVRPTLTAHPTQFYPGSVLGIITDLDKAIQKNDLTRIKQLLA
QLGKTPFFKKEKPTPLDEAISLIWYFENVFYQSASKIHNYIQQNIFDGEDIGNQVINLGF
WPGGDRDGNPFVTTDITLQVAQRLRKTILLNYYRDVRKLKRRLTFRGVHEMVGEIESALY
EMAVTPKDVIKLKLEDFKSKLHQIKDVLEEKHQSLFIDDVNDLLNKLDLFGYHFATLDIR
QDSRIHQSVLEEVVKTSPSELYPDNFSELSEEEQVKILSTVKGKLDPDSFEEGMAKATIS
SIYAMKEIQKKNGEAGANRYIISNCGSVQGVLQPFAFLRSCDWEEPTVDVIPLFETVPDL
QDAHNVMEQLYTNPEYKAHLERRGNKQTIMLGFSDGTKDGGYLMANWSIYKAKEALTKIS
REYGIKVVFFDGRGGPPARGGGKTHQFYASLGPTIENEEIQITVQGQTISSNFGTRDSCT
YNLEQLVSAGISNEVFNPEKNRLREDDRQTMTDLAEISYETYMDFKKHPRFIPYLEKMST
LKYYAKTNIGSRPSSRNKSAELNLSDLRAIPFVGSWSQLKQNVPGFFGVGTAMEALDKKG
EFDRVKQLYENSDFFKTLLENSMMSLTKSFFPLTAYMKNDPEFGEFWELIHEEFERTKKM
LLKVTGYNTLMQNQPAGRASIQARERIVLPLLTIQQHALRMVQQLSKENVDDERLETYEK
MVTRSLYGNINASRNSA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagaaccgagactcgaccgattcaatgataatgttctggcaaaatatcaggta
tacaacagtatcttcctgactttgccgtacgacgacatcaagaagacgggggcgctgctt
cctctttttcttgaaatttgcgaatctggttttgagcaaaacaagaacccttcagaaatt
gttgaacgtttttttcagaaatatggtgaagatcctacggaagaagaaaaggtagccttg
ctattccgcttcattcagtatattgaaagacaagttgtactttttgatgctattgaagat
gcttctttccccatcgtaaataatatggacggccgcggaactttacgaagtgtcaaggaa
gaagctgaagctacccagaaactggatgagttgaagaaattcctgaaacgttttaaagtg
aggccaacccttacagcccacccaactcagttctatcctggttctgttcttggtattatt
actgacctggataaggccattcagaaaaatgacctgaccagaatcaaacaattactggct
cagttagggaaaacaccatttttcaagaaagagaaacctactccgttagacgaggcgatc
agcctgatctggtattttgaaaatgtgttctaccagagtgccagtaaaatccataattac
attcagcagaatatctttgacggagaagatatcggcaaccaggttatcaatttaggcttc
tggcctggaggtgaccgcgatggaaatccgtttgttacaacagatataaccttgcaggta
gctcagcgattgaggaagaccattttgctaaattattacagagacgttcgtaaactgaag
cgaagactaaccttcagaggcgtgcatgaaatggtgggagagatcgaaagtgcactctac
gaaatggcagtaacacctaaggatgttattaaactgaagcttgaagattttaaatctaag
ttgcatcaaatcaaagatgtattagaagaaaaacatcagtcattatttattgatgacgta
aatgatttactgaacaagctcgatcttttcggttatcattttgccactttggatattcgc
caggattcacgaattcaccaaagcgttttagaagaagtggtaaaaacaagcccttcagaa
ttatatccggataatttttcggaattgagtgaagaagagcaggtaaagattctgagcacc
gttaaaggtaaactggatcctgattcttttgaagaaggtatggctaaagctaccatttca
tctatttacgccatgaaggagattcagaagaaaaacggtgaagccggagccaatcgatat
atcatcagtaactgcggaagcgtacagggtgtcctgcaaccatttgcatttcttagatct
tgtgactgggaagaacctacagtagatgtgattccgttattcgaaacagtcccagatctt
caggacgcgcataatgtgatggagcaactctataccaatccggaatacaaagcacacctg
gaacgccgcggaaacaaacaaaccattatgctaggtttcagcgatggtactaaagacggg
ggttacctgatggccaactggagtatttacaaagccaaagaagctttaactaaaatttcc
agagaatacggtatcaaggtcgtcttttttgacggtcgtggaggaccaccggcgcgtgga
ggaggaaaaactcaccagttctatgcttctcttggacctactattgaaaatgaggaaatc
cagatcacggtacaagggcaaaccattagttccaacttcggaacccgggattcctgtacc
tataacctggaacaactggtaagtgccggtatttccaatgaagttttcaatccggaaaag
aatcgtttgcgagaggatgatcgtcaaacaatgaccgatcttgcagagatttcctatgaa
acatatatggacttcaaaaaacacccacgattcattccatatcttgagaaaatgagtacg
ctgaagtattatgccaaaaccaacattggtagcaggccttcttcaaggaataaatcagcg
gaactgaatttaagcgatctgcgtgctattccgtttgttggaagctggagtcagctaaaa
cagaacgttccgggattcttcggagtgggaacagcaatggaagcgctggataaaaaaggc
gaattcgatcgtgtaaaacagttgtatgagaattcagattttttcaaaacgctactggaa
aatagcatgatgagtcttaccaagtcattctttcctttgacagcgtatatgaaaaatgat
cctgaatttggagagttctgggagctgattcatgaagaatttgagcgtactaaaaagatg
ttactgaaagtgactggttacaatactttgatgcagaaccagcctgccggaagagcttcg
atccaggcgcgtgaaagaattgtgttaccattactaaccattcagcagcacgctttaaga
atggtgcagcaattaagtaaagaaaatgtagatgacgagcgtttggaaacatatgagaaa
atggtaacccgttctctctatggaaatatcaacgccagtcgtaattcagcataa

DBGET integrated database retrieval system