KEGG   Gramella forsetii: GFO_2141Help
Entry
GFO_2141          CDS       T00448                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
gfo  Gramella forsetii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GFO_2141
Enzymes [BR:gfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GFO_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2276658..2278112
Genome map
AA seq 484 aa AA seqDB search
MKKIKYFNVFMLAVTLIFSSCSTDDDNNDPLDPTDDGIGTEQPTPAEPEAIDLAAFDNDQ
RVMMQAFYWDVEPRFEWWDLLSEKVPGWADAGVDRIWLPVASKGQSGPFSMGYDPSDYYD
FGNYEQQGTVETRFGSREELENLIATAHDNDLEVIADIVINHNSGGGLQYNPYRDYETYT
LFNEENGNASGMFNRTYEDFYPNSVSEYDPGSLFYPETNLDHHLDRVQNWLWKDENSVAK
YYKNVMGFDGWRFDYVKGFEPWVVKEWLAEVGGFSVGENFDGNPDVLRDWIEASGSAAFD
FSTFYKLEESLDRFKDLTNLEKDMLWKTDPENAVTFTANHDTEKDDNVDNYIASQNKLKA
YAYILTHPGYPTIFYSDYENADFQDEIKQMIAIHNSIATGETEILYVDNDEYVMKRSGTG
TNPGLILYISISNNTKRRTVSSNWNNITLMDYSGNSSYNPTSDENGMVQIEAPSNGYAIY
SITK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaaatattttaatgttttcatgcttgcagtaactttaatttttagttcc
tgctctacagacgatgataacaacgatcctttagatccaacagatgacggaataggaaca
gaacaacctactccagcagaacccgaagcgatagatcttgctgcctttgataatgatcaa
agagtaatgatgcaggctttttactgggacgtagaacctcgctttgagtggtgggatctc
ctttcagaaaaagtacctggctgggcagatgcgggtgttgatcgcatctggcttccggta
gcatccaaagggcaatcaggtccattttctatgggatatgatccttcagattattatgat
tttggaaattatgaacaacagggaaccgtggaaacccgatttggatctcgtgaagaactg
gaaaatctcatcgctacggcccatgataacgatctggaagtaattgcagatattgtaatt
aaccataactctggtggcggacttcaatataatccgtaccgtgactatgaaacttacacc
ctatttaatgaagaaaatgggaatgcttctggtatgttcaatagaacttacgaagatttt
tatcctaatagcgttagtgagtatgatccaggaagtttattttatcctgaaaccaattta
gatcaccacctggacagagtacaaaactggctttggaaagatgaaaactctgtagctaaa
tactacaagaatgtaatgggctttgatggctggcgttttgattatgtaaaaggtttcgaa
ccctgggtagtaaaagaatggcttgctgaagttggtggcttttctgtaggagaaaatttt
gatggaaacccagatgttctccgagattggattgaagcatctggttcagctgcttttgat
ttttctactttttataaactggaagaaagtttggacagatttaaagatcttaccaatctt
gaaaaagatatgctatggaaaacagatccagagaatgccgttacttttacagcaaaccat
gataccgaaaaagatgataatgtagataattatatcgcttctcaaaataaactgaaagcc
tacgcatatattctaacccatccaggatatccaaccatcttttattcagattacgaaaat
gctgattttcaggatgaaataaaacaaatgatcgctattcataatagtatcgcgacagga
gaaactgaaattctttatgttgataatgatgaatatgttatgaaaagaagtggtacaggt
acaaatcctggattaattctatatattagcatcagtaataacacaaaaagaagaactgtt
agttcaaactggaataatattacccttatggattatagcggtaattcatcatacaaccct
acctccgatgaaaatgggatggttcagatcgaggctccgtctaacggatatgcaatttac
tcgattacgaaataa

DBGET integrated database retrieval system