KEGG   Gramella forsetii: GFO_2378Help
Entry
GFO_2378          CDS       T00448                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gfo  Gramella forsetii
Brite
Translation factors [BR:gfo03012]
 Eukaryotic Type
  Elongation factors
   GFO_2378 (tuf)
 Prokaryotic Type
   GFO_2378 (tuf)
Mitochondrial biogenesis [BR:gfo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GFO_2378 (tuf)
Exosome [BR:gfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GFO_2378 (tuf)
  Exosomal proteins of breast cancer cells
   GFO_2378 (tuf)
  Exosomal proteins of colorectal cancer cells
   GFO_2378 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW ATP_bind_1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAL67341
UniProt: A0M3Z6
LinkDB All DBs
Position
complement(2526749..2527936)
Genome map
AA seq 395 aa AA seqDB search
MAKEKYDRSKPHLNIGTIGHVDHGKTTLTAAITKVMADAGYSEASAFDQIDNAPEEKERG
ITINSSHVEYSTEKRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFLNKVDLVDDEELLELVEMEVRDLLSFYEYDGDNGPVISGSALGALE
GDEKWSKTVLELMEAVDTWIELPERDVDKAFLMPIEDVFSITGRGTVATGRIETGVANTG
DPIEIIGMGAGKLTSTITGVEMFRKILDRGEAGDNVGILLRGIEKSQISRGMVITKPGSV
TPHAKFKAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVTGTISLPDGVEMVMPGDNLTI
TVELIQAIAMNQGLRFAIREGGRTVGAGQVTEILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaaatacgaccgttccaaaccgcaccttaatattggtacaattggacac
gtagatcacggaaaaactactttaactgcagcgattactaaggtaatggctgatgctgga
tattcagaagctagtgcgtttgatcaaattgacaacgctccagaagaaaaagaaagaggt
ataactattaactcttctcacgttgagtattcaacagagaagcgtcactatgcacacgtt
gattgtcctggtcacgccgattatgttaagaacatggtaactggtgctgctcagatggat
ggtgctattcttgttgttgctgcgactgatggtcctatgccacaaactcgtgagcacatc
cttcttggacgtcaggttggtattccaagaatcgttgtattcttgaataaagttgacctt
gttgatgatgaagagcttttagagctagttgaaatggaagttagagatcttctttctttc
tacgagtatgatggtgataatggtcctgtaatttcaggttctgcacttggagctttagaa
ggagatgagaaatggtctaagactgttcttgagcttatggaagcagttgatacttggatt
gaacttcctgagcgtgatgttgataaagcattcttgatgcctatagaagatgtattctct
attactggtcgtggtactgttgcaactggacgtatagaaactggtgttgctaatactgga
gatcctatagagattattggtatgggtgcaggaaaacttacttctacaattactggagtt
gagatgttccgtaaaattcttgatagaggtgaagctggtgataacgttggtattcttcta
agaggtattgagaaatctcaaatttctagaggtatggtaattactaagcctggatctgta
actcctcacgctaagtttaaagcagaggtttatatccttaagaaagaagaaggtggacgt
cacactccattccataacaattaccgtcctcagttttacgtacgtacaactgatgtaact
ggaacaattagtcttcctgatggtgtagaaatggtaatgcctggagataaccttactatt
acagtagagcttatccaagcaattgctatgaatcaaggtcttcgttttgctatccgtgaa
ggtggtagaactgtaggtgctggtcaggtaactgaaattctagattaa

DBGET integrated database retrieval system