KEGG   Geospiza fortis (medium ground-finch): 102036737Help
Entry
102036737         CDS       T03755                                 

Definition
(RefSeq) trypsin I-P1-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
Neuroactive ligand-receptor interaction
Influenza A
Brite
KEGG Orthology (KO) [BR:gfr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102036737
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102036737
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102036737
Peptidases [BR:gfr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102036737
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102036737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 249 aa AA seqDB search
MKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCAKNSVPYQVSLNSGYHFCGGSLISSQW
VLSAAHCYKSRIQVQLGKHNLELTESTQQFINSAKVIRHSGFSSYTLDNDIMLIKLATPA
TLSKAVQTVPLPTSCVAAGTTCLISGWGHTLSFAANYPDQLQCLKAPVLTAEQCSDAYPG
QITNNMMCVGYVEGGKDSCQGDSGGPVVCDGQLQGIVSWGYGCAQKGYPGVYTKVCNYVS
WIQSTIASN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctgctgcttctcgcctttattggggtggctgttgccttccccacctttgct
gaagatgatgatgacaagattgtgggaggctacacctgcgcaaagaactcggtgccctat
caggtgtccctgaattctggatatcacttctgtggaggttccctcatcagcagccagtgg
gtcctgtcggctgctcactgctacaaatctcgcatccaagtgcagctcgggaaacacaac
ctggagctcaccgaatccacacagcagtttatcaactctgctaaagtcatccgccactct
ggcttcagctcctacaccctggacaatgacatcatgctcatcaagctggccaccccagcc
acgctcagcaaagctgtccaaaccgttcctctgcctaccagctgcgtggccgccggcacc
acctgcctgatctccggctggggacacactctcagctttgcagccaactaccccgaccag
ctgcagtgcctgaaggctccggtcctcaccgccgagcagtgctctgatgcctaccctggg
caaattaccaacaacatgatgtgtgtcggatacgtggagggaggaaaagactcctgccag
ggagattccggcggtcccgtggtctgcgatggacagctccagggcattgtctcctggggt
tatggatgtgcccagaagggctatcccggagtttacaccaaggtttgcaactacgtctcc
tggatccagtccaccatcgcctccaactga

DBGET integrated database retrieval system