KEGG   Geospiza fortis (medium ground-finch): 102038763Help
Entry
102038763         CDS       T03755                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04210  Apoptosis
gfr04625  C-type lectin receptor signaling pathway
gfr04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:gfr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    102038763 (MAP3K14)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    102038763 (MAP3K14)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    102038763 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102038763 (MAP3K14)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102038763 (MAP3K14)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: STE group
  Other
   102038763 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-GeneID: 102038763
NCBI-ProteinID: XP_014165830
LinkDB All DBs
Position
Un
AA seq 819 aa AA seqDB search
MAPTWRGRHRGRARKKRHKKRSKLKGQPVAAGRRSPRTPEQESCTPIPVQEDESHQSTLY
RNSFWVPEFNKDLGYDPLPFEKPAHAPFSVGKLHSPRSQYKTELHKLISPIQCLNHVWKQ
RDTVPQPETLRPFPYNILPPHFPHVDNPLRAMKQNALDTYIHGDLNYQDSHLSGLNLEYN
FTKCINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLELKEQFHEAS
ENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCAAKKVQVEH
FRAEELTTCAAVSSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCLPEDRALSY
LGQVLEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLGKCLVTGNY
VPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKIAKEPPPL
REIPPSCNPLTAEIIKLGLEKEPLQRASASELKTKTSMALEEVGGVRSPWKGEYREPRHF
SLNKENSAQTSLSPTVSPVSEIGSDPKLSVKVSCGSPLLPPPSLEQTEEVEGPHWNEGKE
LPETCDPPPLSSTPLPLKSCSHVERATTISEQELQQLEIELFLNSLSQPYSLEEQEQMLS
CLSIDSPFVSDASEKNSMKASQSLRDTMSSGIHSWSSQAEGQSCSWNNLLSRSRHTDTPS
CFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQVRHRLELSIPVPAFSLVTKEGQP
VHYNMEVPDSGIELQCTLAPDCSVGWAWRVKHGQLENRP
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggcacccacctggagagggaggcaccggggcagggccaggaagaaaaggcacaagaaa
agatccaagctgaaaggacaacctgtggctgctggcaggagaagtccaagaactccagaa
caggagagctgcaccccaattcctgtccaggaggatgaatcccaccaaagcactctttac
agaaacagtttttgggttcctgaatttaacaaggacttgggctatgatccactgcctttt
gagaagcctgcccatgcccctttttctgtgggcaaactccattccccaaggagccagtac
aaaactgaactgcacaagttgatcagccctattcagtgccttaatcatgtttggaaacag
agggacactgttccccagcctgagactctccgtcctttcccctacaacatccttcccccc
catttcccacacgtggacaatcctctccgtgccatgaagcagaatgctctggacacatac
atccatggtgacctcaactatcaagacagtcacttatctggcctaaacttagaatataat
ttcaccaaatgcatcaaccagtccgtgcaaaccagttctgacaaactttctgtggaagaa
tatttggtagatgccttgaaggggagtgtgagttttggagaaccacaaaatttagccagc
ctggccaagacgtggagaggaggtgggctggagctgaaggaacaattccatgaagcaagt
gaaaatgaaggcgtgctgctgaacgagaagctgaagccggtggattacgagtaccgagaa
gaggttcactggaccaagtgccatggttccttgggcattggctcttttggggaggtgtac
aagatagaggacaagcagacaggattccagtgtgctgccaaaaaggtgcaggtggaacat
ttccgtgccgaggagctgacgacgtgcgcggccgtgagcagccccagcgtggtgcccctg
tacggtgctgtcaaggagggtccctgggtcaccatcttcatgaagctcatggagggtggg
tcattagggcagctcattaaacagagtggctgcctgccagaggacagagccctcagctac
ctgggccaggtgttagagggtctggagtatcttcatgctcaaaacattctccatggagat
gtcaaagctgagaacgtgctgctgtcagatgatgggagcagggccctcctgtgtgacttt
ggccactctgctcacctgcacccagatgggctgggaaagtgcttggtcacagggaactac
gtgcctggcacagagacccacatggcccccgaggtggtgatggggaagcgctgtgactcc
aaggtggacgtgtggagcagctgctgcatgatgctgcacatgctcaatggctgccacccc
tggacccagtactacaaccaccctctctgcctgaagatcgctaaagagccgcctcctctg
agggaaattccaccttcctgcaaccctctcactgctgagattattaagctggggctggag
aaggagcctctgcagagggcgtctgcatcagagctcaaaaccaagaccagcatggcactt
gaggaagtgggaggtgtgagaagcccttggaaaggtgaatacagagagcccagacatttc
tctttgaacaaagaaaacagtgcacagacatccctgtcccccacagtgagcccagtttct
gagattggttctgacccaaaactgtcagtcaaagtttcctgtggcagcccactcctacca
cctccatctctggagcaaacagaggaggttgagggacctcactggaatgagggcaaggag
ttacctgagacctgtgatcccccacccctctcctcaactcctctgcccctgaagagctgc
agccacgtggaaagagccacaaccatttcagagcaagaacttcagcagctggaaattgaa
ctgtttctgaacagcctttcccagccttactctctggaagagcaagagcaaatgctttca
tgcctcagcattgacagcccctttgtgtcagatgccagtgagaagaactccatgaaggct
tctcagagcttgagggacaccatgagctctgggatccattcctggagcagccaggcagag
gggcagagctgcagctggaacaacctgctgagccgcagccggcacacggacacccccagc
tgcttcaacggagtgaaaatccagatccagttgctaagtggagaaaatttgcacatcaga
gatttccacaggacaaaggtgggagacattgccacggggataagcagccaggtgagacac
agactggagctcagtatccccgtgcctgccttcagcctggtgaccaaggaggggcagcct
gtgcactacaacatggaggtgcctgactctggcatcgagctgcagtgcaccctggccccc
gactgcagcgtgggctgggcctggcgcgtcaagcacggccagctggagaacaggccctga

DBGET integrated database retrieval system