KEGG   Geospiza fortis (medium ground-finch): 102042035Help
Entry
102042035         CDS       T03755                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102042035 (PCSK1)
Peptidases [BR:gfr01002]
 Serine Peptidases
  Family S8: subtilisin family
   102042035 (PCSK1)
Chaperones and folding catalysts [BR:gfr03110]
 Intramolecular chaperones
  Subtilisin family
   102042035 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 698 aa AA seqDB search
MLQKANIGSLKNHYLFRHKSHPRRSRRSAIHITKRLSDDERVSWAEQQYEKKRTKRAAMR
DSAESLFNDPMWNQQWYLQDTRITPSLPKLDLHVIPVWQKGFTGKGVVITVLDDGLEWNH
TDIFANYDPKASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNRKCGVGVAYNSR
VGGIRMLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGINQ
GRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATA
YSSGDYTDQRITSVDLHNECTETHTGTSASAPLAXXXXXXAGIFALALEANPDLTWRDMQ
HLVVWTSEYDPLAGNPGWKKNGAGLMVNSRFGFGLLNANALVDLADPKRWKSVPEKRECI
VKDKSFEPRLLRANEEVIIEIPTKACEGQENSIASLEHVQLEATIEYSRRGDLHVTLVSP
SGTSTVLLAERERDKSPNGFKNWDFMSVHTWGENPAGTWILRITDMSRRIQNEGRIVNWK
LILHGTATQPEHMKQPRVYTSYNAVQNDRRGVEKMTDLVEDHTTLESLSEKPKATEHTSS
DKAEDKTPSEAMLHLLQSAFSRQMDQKQLPKKTASEKLNIPYEHFYQALRKLNKPSQLRG
SEESLYSDYVDLFYNAKPYKHRDDRLLQALVDIINEGN
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagaaagcaaatattggatcactgaaaaaccactacttattcaggcataagagt
cacccaagacggtcccgaagaagtgctattcatatcactaagagactttctgatgatgag
cgggtgtcatgggcagagcagcagtatgaaaaaaagcgaaccaagcgtgccgccatgaga
gactcagctgaaagccttttcaacgaccctatgtggaatcagcagtggtatctgcaagat
acaagaattactccatccctgcccaaactggatctccatgttattcctgtgtggcagaaa
ggattcacaggcaagggagtcgtcatcacagtcctggatgatggattggagtggaatcac
actgacatctttgctaactatgacccaaaggcaagttacgatttcaacgacaatgatcat
gatccctttcctagatatgacccaacaaatgaaaacaagcatgggacacggtgtgcaggg
gaaattgccatgcaagccaacaacagaaaatgtggagttggagtagcctacaattccagg
gttggaggtatacggatgctggatggaatagtcaccgatgctattgaggccagctcaatt
ggtttcaacccagaacatgtggatatttacagtgcaagctggggccctaatgatgatggc
aaaactgtggagggacctgggagactggcacagaaggctttcgagtatgggataaaccag
ggtcgaaatgggaaaggctccattttcgtgtgggcctcagggaatggaggtcgtcagggt
gacaactgtgactgtgatggttacactgatagcatctacaccatctccattagcagtgct
tctcagcaagggctttctccctggtatgcagagaagtgctcttcaactctggccacagca
tacagcagcggggattacactgaccaaagaataacaagtgttgatcttcacaatgaatgt
acagaaactcacacagggacctctgcatctgcacctctggcannnnnnnnnnnnnnnnnn
gcaggaatttttgctctggcgctggaagcaaacccagatctaacatggagggatatgcag
cacttggtagtgtggacctcagaatatgatccgctggctggaaatccaggatggaaaaaa
aatggagcaggactgatggtcaatagccgatttgggtttgggctacttaatgccaatgcc
ttggtggatttagctgatcccaaaagatggaaaagtgtaccagaaaagagagagtgcatt
gtcaaagacaagagctttgaacccagattattaagagcaaatgaagaagtgattattgaa
attcccacaaaagcctgcgagggtcaagagaactccattgcatctctggagcatgtgcag
ctcgaggccacaattgagtattcccgtagaggtgatctgcatgtcactctggtttctcca
tcagggaccagcactgtcttactggctgagagagagagggacaaatctcccaatggcttc
aagaactgggacttcatgtctgtccacacatggggggaaaatccagcaggcacctggatt
ttaagaattactgatatgtccagacgaatacaaaatgaggggaggattgtaaattggaaa
ttgattttgcatggcactgctacccagcctgaacacatgaagcagccacgtgtgtataca
tcctacaatgctgtgcagaatgacagaagaggagtggaaaagatgacagatcttgtagag
gaccataccacactggagagcctgagtgaaaaacccaaggccacagaacacaccagcagt
gacaaagcagaagataaaaccccatcagaagccatgctgcatttactgcaaagtgctttt
agcagacagatggatcagaagcagctgccaaagaagactgcaagtgagaagttaaacatt
ccatacgaacacttctatcaagccctcagaaaattgaacaagccctcccagttaagaggc
tcagaagaaagtctgtacagtgactacgttgatcttttttacaatgccaaaccttacaag
cacagagatgatagactgctgcaagcgttagttgatatcataaatgaaggaaattaa

DBGET integrated database retrieval system