KEGG   Gallus gallus (chicken): 373889Help
Entry
373889            CDS       T01006                                 

Gene name
HK1, hexokinase-1
Definition
(RefSeq) hexokinase 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    373889 (HK1)
   00051 Fructose and mannose metabolism
    373889 (HK1)
   00052 Galactose metabolism
    373889 (HK1)
   00500 Starch and sucrose metabolism
    373889 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    373889 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    373889 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    373889 (HK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     373889 (HK1)
Membrane trafficking [BR:gga04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    373889 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
LinkDB All DBs
Position
6
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLIDIMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIIH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELPTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLAASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRTEMEAGLKKKSHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIRGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNMEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGGVSKRAAQLCGAGMAA
VVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLLSEDGSGKG
AALITAVGCRVRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcaccgagctcaaggaggatcaggtcaaa
aagatcgataaatacctttacgccatgcggctctctgatgaaactctgatagacatcatg
gctcgcttccggagagaaatgaagaatggcctctccagagattttaacccaacagcgaca
gtgaaaatgctccctacctttgtgaggtccattcctgatggctcagagaaaggagatttc
atcgctctggatctcggtggttcttactttcgaattctgcgggtgaaagtatcgcatgaa
aagaagcagacggtacaaatggaaagtgaaatttataatacacctgaagatatcattcat
ggcagtgggacacggctttttgatcatgttgccgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaattaccggttgggtttaccttctctttcccgtgccgacaa
tctaagctggatgagggcattctgataacctggacgaagcgcttcaaagcgagcggagtg
gagggagcagacgttgtgaagctgcttaacaaggccatcaagaaacgtggggactatgat
gcagatatcatggctgttgtgaacgataccgttggcactatgatgacctgtggttttgat
gaccaacgttgtgaagttggcttgatcattggcactggtaccaatgcctgttacatggag
gagatgcggcacattgacctggtggaaggggacgagggcaggatgtgcataaacacagag
tggggggcctttggggatgacggctcactagaagacatcaggacagagtttgatagagag
atcgaccgtggatccctaaatcctggcaagcaactgtttgagaagatggtcagcgggatg
tacatgggggagctggtgaggctcatcctggtgaagatggccaaggagggactgctcttt
gaggggagaatcacccctgagcttcccaccaaaggaaagtttgagacaaagcatgtttct
gccatagaaaagagcaaagaaggtttgaacaaagccaaagaaatcttaacccgcctgggg
gtggagccgtcccacgaggactgcatcgcagtccagcacgtctgcaccatcgtgtccttc
cgctcggccaacctggcggcctccacgctgggtgccatcctcaaccagctgcgggataac
aaaggggtcggccgcctccgcaccaccgtgggtgtcgatggctccctctacaagatgcat
ccacagtatgctcggcgcttgcacaaaaccacccggcgcctggtgcctgactcggatgtg
cggttcctgctgtcggagagcggcagtgggaaaggggcggcgatggtgacggcggtggcg
taccggctgtcggagcagcaccggctcatcgacgagacgctggctgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgaggacagagatggaagcaggcctgaag
aagaagagtcacgagactgccaaagtgaaaatgctgcccacctttgtccgcagcacgccg
gatggcacagagaacggagactttctggcgcttgaccttggagggacaaacttcagagtg
ttgctggtgaaaattcgcagtggtaaaaggagaacggttgaaatgcacaacaagatctat
gcaattcctatagaggtgatgcagggaacgggagaagagctgtttgaccacatcgttacc
tgcatttcggacttcctggattatatgggaataagaggtgcacggcttcctcttggcttc
acattctccttcccttgcaagcagaccagtctggacgctggtatccttctcaactggaca
aaaggattcaaagctacagactgtgagggtgaagacgtggtgtatttgctaagagaagga
attaaaagaagagaggagtttgacttggatgtggtagctgtagtgaacgatacggtgggc
acgatgatgacctgtgcttatgaagacccaaactgtgaaattggactcattgtgggaact
ggcagcaatgcctgttacatggaggagatgagaaacatagagatggtggatggtgagcaa
ggacggatgtgtgtgaacatggagtggggagctttcggggataatggatgcctggacgat
atcaggacaatatatgacaaagcagttgatgactattcactaaatgctggaaagcaaagg
tatgagaagatgatcagtgggatgtacctgggggaaatagtccgcaatattttgattgac
ttcaccaaacgagggttcctgttcagaggacagatctcagagactctgaaaaccaggcat
atctttgaaaccaagttcctttcacagattgagagcgacaggttagccttgcttcaggtg
cgaaccattctccagcagctggggctcaacagcacgtgcgatgacagtatcattgtcaag
acagtgtgcggaggggtgtcaaagcgagcagctcagttatgtggtgccggaatggctgcc
gttgtagataaaattagggagaacagaggcttagagcacctggagataacggttggtgtg
gatgggactctgtacaaactacacccacacttttcgaggattatgcaccaaacagtcaaa
gacctggcacccaagtgtgatgtgaccttcctgctctcggaggacggcagtgggaaaggg
gcagcgctcatcacggcggtgggatgcagggttcgcgatgctgagcagaactga

DBGET integrated database retrieval system