KEGG   Gallus gallus (chicken): 395938Help
Entry
395938            CDS       T01006                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1, soluble
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    395938 (SOD1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     395938 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 154 aa AA seqDB search
MATLKAVCVMKGDAPVEGVIHFQQQGSGPVKVTGKITGLSDGDHGFHVHEFGDNTNGCTS
AGAHFNPEGKQHGGPKDADRHVGDLGNVTAKGGVAEVEIEDSVISLTGPHCIIGRTMVVH
AKSDDLGRGGDNESKLTGNAGPRLACGVIGIAKC
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctgaaggccgtgtgcgtgatgaagggggacgcccccgtggagggggtcatc
cacttccagcagcaggggagcgggccagtaaaggttactggaaaaattaccggcttgtct
gatggagatcatggcttccatgtgcatgaatttggagacaacacaaatgggtgtaccagc
gcaggtgctcactttaatcctgaaggcaagcagcacggtggaccaaaagatgcagatagg
cacgtgggtgacctcggcaatgtgactgcaaagggaggagtggcagaagtagaaatagaa
gattctgtcatttctcttaccggaccacactgcatcattggccgtaccatggtggtccat
gcaaaaagtgatgacctgggtagagggggagataatgagagcaaactaactggaaatgct
ggacctcgtttagcttgtggtgtaattggaatagccaagtgctaa

DBGET integrated database retrieval system