KEGG   Gallus gallus (chicken): 419215Help
Entry
419215            CDS       T01006                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     419215 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
LinkDB All DBs
Position
20
AA seq 691 aa AA seqDB search
MAAAAQPSTDWHVKENGRDHHTSKFSSKELIVRRGQAFVITFNGVEQPEQTLTFIVETGP
KPSKQAKTQATFGISSTVSKDSWSAVLQSTSSHSVSVSISSPPNAVIGRYKLSVQSTSTG
SSSPETLGTFVLLFNPWSSGDNVFMPNKAECEEYVLEEFGIIFAGNNYHINSFGWNFGQF
QADILNICLSMLDRSLNYRQDPATDVSHRHDPKYLGRVLSAMVNANDDQGVVLGNWSGNY
DGGKSPSSWTGSGEILQSWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRPITNFSSAH
DADGNLRVDEFYDASGNHLNEGADSVWNFHVWNESWFSRSDLGPSYSGWQILDATPQEES
GGIYQCGPASRNAVKEGDVDLDYDCPFVFAEVNADCMYWSYDRATRKKTLLFNKSTVIGQ
LISTKAVGRDDRIDITSDYKYEEGSKKERDIFKKARKKLGLEDKFDPTAPTPKEIEQKPD
ISGKFKMAGPLEVGKDLNLILVLKNLQSEVKSVNVNMTAWSTVYTRRPVREIWKDSLSVS
LSPEEEKHFPIKISYAEYQQQLTTDNAIEVTALCHVEGGIQVLVQRHIALDNPTIDIQVL
GEAKVNEEMDVEVVFTNPIDIEVKDCVLQVEGSDLVRGILKIDVPPLKAKDISSTKFKLT
PFETGSKHLLVNFSCDKFADIKAFKTVKVID
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagcgcagccaagtactgactggcacgtgaaagaaaatgggagagatcac
cacacaagtaaattctctagcaaagagttgattgtgaggagaggtcaggcctttgtaatc
accttcaatggagtagaacagcctgagcaaaccttaacattcatcgtagaaacaggtcca
aaaccctccaagcaggccaagacccaagccacatttggtatctccagcacagtgagcaag
gacagctggagcgcagttcttcagtccaccagttcccactccgtgagtgtctccatttcc
agcccacctaatgctgtcatcggacgctacaagctgagtgttcaaagtacttcaactggc
agctcgtctccagaaacccttggcacttttgttttgctcttcaacccttggtcttcaggt
gataatgtgttcatgcctaacaaggctgagtgtgaggaatatgtgctagaagagtttggt
atcatttttgcgggcaacaattatcatatcaacagctttggatggaactttggccagttt
caagcagatatcctcaatatttgcctttccatgctggatcgaagcttgaactaccgtcag
gatcctgccacagatgtatctcaccgacacgatcccaaatatctgggccgtgttctcagc
gcaatggtcaatgccaatgatgaccaaggggtggtactaggaaactggagtggaaattat
gatggtggaaaaagtccaagcagctggactggaagtggtgaaatcctacaaagctggaag
aaatcaggattcaagcctgttagatacggacagtgttgggtttttgcagcagtattaacc
acagtacttagatgtctggggattcccactcgtccaattacaaacttcagctctgcccat
gatgcagatggaaacctgcgtgtggatgagttttacgatgcttctggaaatcatttgaat
gagggagctgacagtgtctggaatttccacgtctggaatgaaagctggttttcccgcagt
gacttgggcccttcatacagtggatggcaaattctggatgcaactccccaggaagaaagt
ggaggaatttatcaatgtggtcctgcctcaaggaatgccgtcaaagaaggagacgtagat
ctggactacgactgtccatttgtatttgcagaagtgaatgcagactgtatgtactggagt
tatgatcgtgctactagaaagaaaactttattattcaacaagtcgacagtaattggccaa
ctcatcagcacaaaggcagttggtagagatgatcgtatagatatcaccagtgattacaaa
tatgaagaaggctctaaaaaagaaagagatattttcaaaaaagcccgtaagaagctggga
cttgaggataagtttgatcctacagcaccaacaccaaaggaaattgaacaaaagcctgat
atctcaggaaagtttaagatggctggtcctttagaggtcggcaaagacctcaatttaatt
ctggttcttaaaaatttacaatctgaagttaagtctgttaatgtgaatatgactgcttgg
agcactgtgtacacaagaagaccagttcgtgagatctggaaggactccctgtctgtctct
ctgtctcctgaggaagagaaacattttcccattaagatatcttatgctgaatatcaacag
cagttaactacagataacgcgattgaagtaacagctttatgtcacgtagaaggtgggatt
caagtactggtgcaaagacacattgccctggacaaccctaccatcgacatacaggtactt
ggtgaggcaaaagtgaatgaagaaatggatgtggaagtggtatttaccaatcctattgat
atagaagtgaaggactgtgtgctgcaggtagaaggcagtgacctggtgagaggaatcctt
aagatagatgtaccaccactgaaagccaaagacatatccagtacaaaatttaaacttacc
ccttttgagacgggctccaagcatctgcttgtaaatttctcctgtgataaatttgcagat
atcaaggcctttaaaactgtaaaggtgattgactaa

DBGET integrated database retrieval system