KEGG   Gallus gallus (chicken): 422182Help
Entry
422182            CDS       T01006                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     422182 (HDAC8)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     422182 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 422182
NCBI-ProteinID: XP_004940661
CGNC: 3582
Ensembl: ENSGALG00000004825
LinkDB All DBs
Position
4
AA seq 395 aa AA seqDB search
MGALRFPACPAREQHFPACPARGLQLPACPAAVRPGGPARCGGPDGGGAARGLRVQPGVR
GPLRLPLQSAQTGQHGALVDRGVLLARPHDDNQAQSGFHGGDGKLPHRRLPAAPAEGYDC
PATEGIFDYAAAVGGATITAAQCLLDGKCKVAINWPGGWHHAKKDEASGFCYLNDAVLGI
LRLRQKFDRILYIDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVTDIGLGKG
RYYSVNVPIQDGIQDEKYYQICETVLKEVYAAFNPEAVVLQLGADTIAGDPMCSFNMTPE
GVGKCLKYVLQWQLATLILGGGGYNLANTARCWTYLTGVILGRTLSSEIPDHEFFTEYGP
DYVLEITPSCRPDRNDPQRIQEILNLIKGNLKHVV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggagcactacgtttcccagcgtgccccgcgcgggagcagcacttcccagcatgcccc
gcgcgcggactacagctcccggcgtgccccgcggcagtgaggccgggcggcccggcccgg
tgtggcggccctgatggcggcggggccgcccgtggcctacgtgtacagcccggagtacgc
ggccctctgcgactccctctgcaaagtgcccaaacgggccagcatggtgcactcgttgat
cgaggcgtactccttgctcgaccacatgatgataatcaagcccaaagtggcttccatgga
ggagatggcaagcttccacacagacgcttacctgcagcacctgcagaaggttacgactgt
ccagctactgaagggatctttgactacgcagcagccgtggggggagccaccatcaccgca
gcccagtgcctgctggatggcaagtgcaaggtagcaattaactggcctggagggtggcat
cacgcaaagaaagatgaagcttctggtttttgttacctgaatgatgctgtcctggggatc
ctgcgactgcgccagaaatttgaccgcatcctttatattgatttggatttgcatcatggg
gatggtgttgaagatgcctttagcttcacctcgaaggtcatgactgtttctctgcacaag
ttttcgccaggatttttcccaggcacaggggatgtgacagatattggcctggggaaaggt
cgctattacagtgtgaatgtgcctatccaagatggcattcaagatgagaaatattaccag
atctgtgaaactgtgctgaaggaggtgtacgctgccttcaaccctgaggcagtggtgcta
cagctgggggctgacaccattgctggagaccccatgtgctccttcaacatgacgcccgag
ggagtgggcaagtgcctgaagtacgtcctgcagtggcagctggcaactctcatcctggga
ggaggaggctacaaccttgccaacacagcccgctgctggacgtacttgactggggtcatc
cttggcagaacgctgtcctctgagatccctgatcatgagttcttcacagagtatggtcct
gactacgtgctggagatcacacccagttgcagaccggaccgcaacgatccacagagaatt
caagaaattctcaacttgatcaaaggcaatctgaagcacgtggtttag

DBGET integrated database retrieval system