KEGG   Gallus gallus (chicken): 429027Help
Entry
429027            CDS       T01006                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00601  Glycosphingolipid biosynthesis - lacto and neolacto series
gga01100  Metabolic pathways
Module
gga_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    429027 (B3GALT1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     429027 (B3GALT1)
Glycosyltransferases [BR:gga01003]
 Glycan extension
  Type 1 chain
   429027 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 429027
NCBI-ProteinID: XP_004942835
CGNC: 8306
Ensembl: ENSGALG00000010931
UniProt: E1C4T5
LinkDB All DBs
Position
7
AA seq 326 aa AA seqDB search
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGHRQVSSISIARKNVSFGNIRTRPINP
HSFDFLINEPNKCEKSVPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATYCSKAKYVMKTDSDI
FVNMDNLIYKLLKPNTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQITPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaaggtctcatgcttgtacgttttgacagtagtttgctgggcaagcgctctc
tggtacttaagtataactcgtcctacttcttcctacactggccacagacaggtcagtagc
atatcaatagccagaaaaaatgtctcctttggcaacataagaactcgacctataaatcca
cattcttttgattttctcatcaacgaacctaataaatgtgagaagagtgtccctttcttg
gtcattcttatcagcacaactcacaaagagtttgacgcaaggcaagcaattcgggaaaca
tggggagacgaaaacaattttaaaggaattaagattgccacgctatttcttcttgggaaa
aatgcagatcctgtgttaaatcagatggtagagcaagaaagccaaatttttcacgacatt
attgtagaggattttattgactcctatcataacctcactctgaaaacattaatggggatg
aggtgggtagcaacatattgttcaaaagcgaagtacgttatgaagacagacagtgatatt
tttgtaaatatggataatcttatttataagctgctcaaacctaacaccaagccaaggaga
aggtacttcactggttacgttatcaacggagggccaatacgagacgttcgcagcaagtgg
tacatgcccagagatttgtatcctgacagcaattacccacccttctgttcgggcactggc
tacattttttcagcagatgtagcagaactgatttacaaaacctcccttcacaccagactc
ctccatctcgaagacgtgtatgtcggactctgtcttcggaagctgggcatccaccccttc
cagaacagtggcttcaaccactggaaaatggcctacagcttgtgcaggtaccgcagggtg
atcacagtgcaccagataacaccagaagaaatgcacagaatttggaatgacatgtcaagc
aagaagcatcttagatgctaa

DBGET integrated database retrieval system