KEGG   Gallus gallus (chicken): 771857Help
Entry
771857            CDS       T01006                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
gga  Gallus gallus (chicken)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    771857 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    771857 (CDC23)
   04114 Oocyte meiosis
    771857 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    771857 (CDC23)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     771857 (CDC23)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    771857 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
LinkDB All DBs
Position
13
AA seq 586 aa AA seqDB search
MAAVGAVVGLGNADFSDLREIKKQLLSVAERSRERGLQHSGKWASELAFALEPLLLSELP
PPPALTEEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEKKKD
DETVDSLGPLEKGQVKNEALRELRVELSKKHKAQELDGFGLYLYGVVLRKLDLAKEAIDV
FVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKY
QSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRS
MKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLM
GHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPN
DSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYI
KYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCSFNDTREEGKALLR
QILQLRNQGETSSTEIATPFFLPASLSANSTPTRRVSPLNLSSVTP
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgggagcggtggtggggttggggaatgctgacttctcggacttacgggag
atcaagaagcagttgctgagcgtggcggagcgcagccgtgagcgcggcttgcagcacagt
gggaaatgggcctccgagctggccttcgccctggagccgctgctgctgagcgagctgccg
ccgccgcccgcgctcacggaggaggatgctcgtgatctggatgcctatacattagccaaa
tcttactttgatctaaaggaatatgacagagctgcatatttcttacggggctgcaagagt
cagaaagcttacttcttgtatatgtactctagatacctgtcaggggaaaagaagaaggat
gatgagacagtggatagtttgggaccactggaaaaaggacaggtgaaaaatgaagctcta
cgagagcttagagttgagctcagtaagaagcacaaagcacaggaactggatggatttggc
ctttatctgtacggtgttgtgctgcggaagctggacctggctaaagaagcaatagatgta
tttgttgaagctactcatgtcttacctttgcactggggagcttggctggaactttgcaac
ttgattacagataaagagatgttgaagttcctgtccttgccagatacgtggatgaaagag
ttctttcttgcacacatttatacagagctccagctgatagaggaggctctgcagaagtat
cagagtctcatcgatgcaggattttctaaaagcacatatatcatctctcagattgcagtt
gcctaccacaatatacgagatattgacaaagctttatctatctttaacgagctacggaaa
caagatccttacagaatagaaaatatggatactttctccaacttgctgtatgtcaggagc
atgaagcctgaactgagctacctggctcacaatctctgtgagatagacaagtatcgtgtt
gagacctgctgtgtaattggaaattattatagcttacgtagccagcatgaaaaagcagca
ctgtatttccagagagccttgaaactgaatcctcgttatctgggagcctggacgcttatg
ggacatgaatacatggaaatgaagaacacatctgctgctatccaggcttatagacatgca
atagaggtgaacaaaagggattacagagcctggtatggtttgggacaaacctatgaaatc
ctcaaaatgccattttactgtctctattattaccgacgggcccaccagctcagacccaat
gattctcgtatgctggttgccctaggagaatgctatgagaaactcaatcagttggtggaa
gctaaaaagtgttactggagggcttatgctgtgggagatgtggagaaaatggcattggtg
aaactagcaaagctgcatgaacagctgaatgaatccgaacaggctgctcagtgttatatc
aaatacatccaggacatctattcctgtggggagatagtggagcacctggaggttagcact
gccttccgttaccttgcccagtactacttcaagtgtaagctctgggatgaagcctcagct
tgtgctcagaaatgctgctcattcaatgatactagagaagaaggaaaggcactgctgcgg
caaatcttacagcttcgcaaccaaggagagacctcctccacagagattgctactcccttt
ttcctcccagcatcactgtcagccaatagcactcccacacgtcgcgtctccccgctcaat
ctatcttctgttacaccgtga

DBGET integrated database retrieval system