KEGG   Geobacillus sp. GHH01: GHH_c34760Help
Entry
GHH_c34760        CDS       T02455                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00240  Pyrimidine metabolism
ggh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GHH_c34760 (tdk)
Enzymes [BR:ggh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GHH_c34760 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AGE23966
UniProt: L8A4Q3
LinkDB All DBs
Position
complement(3467631..3468254)
Genome map
AA seq 207 aa AA seqDB search
MYVMTQSGWLELICGCMFSGKSEELIRRVRRAQFAKQEVKVFKPTIDNRYSEDAVVSHNG
NSVIAIPVATPAEMFRYISAATDVVAIDEIQFFSDDIIDVVQTLADCGYRVIAAGLDQDF
RGEPFGPVPALMAIAESVTKLQAVCTVCGSPASRTQRLINGAPASYDDPVILVGASEAYE
PRCRHHHEVPGKPKKRYNRPLAGHTGE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgatgacgcagtccggctggcttgagctcatttgtggatgcatgttttccggc
aaatcagaagaattgattcgccgcgtccgccgcgctcagtttgccaagcaggaagtgaaa
gtgttcaaaccgacgatcgacaatcgttatagcgaagacgcagtcgtgtcgcacaacggc
aattcggtgatcgccattccggtcgcgacgccggcggaaatgttccgctacatttccgcc
gccaccgacgtcgtcgccatcgatgaaatacagtttttttccgacgacatcatcgatgtg
gtgcaaacgctcgctgattgcggctaccgcgtcatcgccgcggggctcgaccaagatttt
cgcggcgaaccgtttggccccgtgccggcgctgatggcgatcgctgagtcggtgacgaag
ctgcaggcggtttgcacggtatgcggttccccggccagccggacgcagcggctcattaac
ggtgcgcccgcctcttatgacgatccggtgattctcgtcggcgccagcgaggcgtacgag
cctcgctgccgccatcaccatgaagtgcctggcaaaccgaaaaagcgatacaaccgcccg
cttgctggacatacgggtgagtga

DBGET integrated database retrieval system