KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131029Help
Entry
101131029         CDS       T02442                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101131029 (HK1)
   00051 Fructose and mannose metabolism
    101131029 (HK1)
   00052 Galactose metabolism
    101131029 (HK1)
   00500 Starch and sucrose metabolism
    101131029 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101131029 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101131029 (HK1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    101131029 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101131029 (HK1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    101131029 (HK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101131029 (HK1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101131029 (HK1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101131029 (HK1)
Membrane trafficking [BR:ggo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101131029 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
10
AA seq 921 aa AA seqDB search
MGQICQRESATAAEKPKLHLLAESEIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FHLTKDMLLEVKKRMRAEMELGLRKQTHNNAAVKMLPSFVRRTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNG
CLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRTEASS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatctgccagcgagaatcggctacagcagctgaaaaaccaaaacttcatcta
cttgctgaaagtgagattgacaagtatctctatgccatgcggctctccgatgaaactctc
atagatatcatgactcgcttcaggaaggagatgaagaatggcctctcccgggattttaat
ccaacagccacagtcaagatgttgccaacattcgtaaggtccattcctgatggctctgaa
aagggagatttcattgccttggatcttggtgggtcttcctttcgaattctgcgggtgcaa
gtgaatcatgagaaaaaccagaatgttcacatggagtccgaggtttatgacaccccagag
aacatcgtgcacggcagtggaagccagctttttgatcatgttgctgagtgcctgggagat
ttcatggagaaaaggaagatcaaggacaagaagttacctgtgggattcacgttttctttt
ccttgccaacaatccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaa
gcgagcggagtggaaggagcagatgtggtcaagctgcttaacaaagccatcaaaaagcga
ggggactatgatgccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacc
tgtggctatgacgaccagcactgcgaagtcggcctgatcatcggcactggcaccaatgct
tgctatatggaggaactgaggcacattgatctggtggaaggagacgaggggaggatgtgt
atcaatacagaatggggagcctttggagacgatggatcattagaagacatccggacagag
tttgacagggagatagaccggggatccctcaaccctggaaaacagctgtttgagaagatg
gtcagtggcatgtacttgggagagctggttcgactgatcctagtcaagatggccaaggag
ggcctcttatttgaaggacggatcaccccggagctgctcaccagagggaagtttaacacc
agtgatgtgtcagccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctg
acccgcctgggagtggaaccgtccgatgatgactgtgtctcagtccaacacgtttgcacc
attgtctcatttcgctcagccaacctggtggctgccacgctgggcgccatcttgaaccgc
ctgcgtgataacaagggcacacccaggctgcggaccacggttggtgtcgacggatctctt
tacaagacgcacccacagtattcccggcgtttccacaagactctgaggcgcttggtgcca
gactccgatgtgcgcttcctcctctcggagagtggcagcggcaagggggctgccatggtg
acggcggtggcctaccgcttggctgagcagcaccggcagatagaggagaccctggctcat
ttccacctcaccaaggacatgctgctggaggtgaagaagaggatgcgggccgagatggag
ctggggctgaggaagcagacgcacaacaatgccgcggttaagatgctgccctcctttgtc
cggagaactcccgacgggactgagaatggtgacttcttggccctggatcttggaggaacc
aatttccgtgtgctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcac
aacaagatctacgccattcctattgaaatcatgcagggcactggggaagagctgtttgat
cacattgtctcctgcatctctgacttcttggactacatggggatcaaaggccctaggatg
cctctgggcttcacgttctcatttccctgccagcagacgagtctggacgcgggaatcttg
atcacgtggacaaagggttttaaggcaacagactgcgtgggccacgatgtagtcacctta
ctaagggatgcgataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaac
gacacagtgggcaccatgatgacttgtgcttatgaggagcccacctgtgaggttggactc
attgttgggaccggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtg
gagggggaccaggggcagatgtgcatcaacatggagtggggggcctttggggacaacggg
tgtctggatgatatcaggacacactacgacagactggtggacgaatattccctaaacgct
gggaaacaaaggtatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaac
atcttaatcgacttcaccaagaagggattcctcttccgagggcagatctctgagccgctg
aagacccggggcatctttgagaccaagtttctctctcagatcgagagtgaccgattagca
ctgctccaggtccgggctatcctccagcagctgggtctgaatagcacctgcgatgacagt
atcctcgtcaagacagtgtgcggggtggtgtccaggagggccgcgcagctgtgtggcgca
ggcatggctgcagtggtggataagatccgcgagaacagaggactggaccgtctgaatgtg
actgtgggagtggacgggacactctacaagcttcatccacacttctccagaatcatgcac
cagacggtgaaggaactgtcaccaaaatgtaacgtgtccttcctcctgtctgaggatggc
agcggcaagggggccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagc
agctaa

DBGET integrated database retrieval system