KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142713Help
Entry
101142713         CDS       T02442                                 

Gene name
HDAC11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101142713 (HDAC11)
  Substance dependence
   05034 Alcoholism
    101142713 (HDAC11)
  Infectious diseases
   05165 Human papillomavirus infection
    101142713 (HDAC11)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101142713 (HDAC11)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     101142713 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
3
AA seq 347 aa AA seqDB search
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSML
VEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
NIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTLLLPPAVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctacacacaacccagctgtaccagcatgtgccagagacacgctggccaatcgtgtac
tcgccgcgctacaacatcaccttcatgggcctggagaagctgcatccctttgatgccgga
aaatggggcaaagtgatcaatttcctaaaagaagagaagcttctgtctgacagcatgctg
gtggaggcgcgggaggcctcggaggaggacctgctggtggtgcacacgaggcgctatctt
aatgagctgaagtggtcctttgctgttgctaccatcacagaaatcccccccgttatcttc
ctccccaacttccttgtgcagaggaaggtgctgaggccccttcggacccagacaggagga
accataatggcggggaagctggctgtggagcgaggctgggccatcaacgtggggggtggc
ttccaccactgctccagcgaccgtggcgggggcttctgtgcctatgcggacatcacgctc
gccatcaagtttctgtttgagcgtgtggagggcatctccagggctaccatcattgatctt
gatgcccatcagggcaatgggcatgagcgagacttcatggacgacaagcgtgtgtacatc
atggatgtctacaaccgccacatctaccctggtgaccgctttgccaagcaggccatcagg
cggaaggtggagctggagtggggcacagaggatgatgagtacctggataaggtggagagg
aacatcaagaaatccctccaggagcacctgcccgacgtggtggtatacaatgcaggcacc
gacatcctcgagggggaccgccttggggggctgtccatcagcccagcgggcatcgtgaag
cgggatgagctggtgttccggatggtccgtggccgccgggtgcccatccttatggtgacc
tcaggcgggtaccagaagcgcacagcccgcatcattgctgactccatacttaatctgttt
ggcctggggctcattggacctgagtcacccagtgtctctgcacagaactcagacacactg
ctgcttccccctgcagtgccctga

DBGET integrated database retrieval system