KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148332Help
Entry
101148332         CDS       T02442                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101148332 (HDAC6)
  Substance dependence
   05034 Alcoholism
    101148332 (HDAC6)
  Infectious diseases
   05165 Human papillomavirus infection
    101148332 (HDAC6)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101148332 (HDAC6)
Protein phosphatases and associated proteins [BR:ggo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101148332 (HDAC6)
Messenger RNA biogenesis [BR:ggo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101148332 (HDAC6)
Membrane trafficking [BR:ggo04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    101148332 (HDAC6)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101148332 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
X
AA seq 1215 aa AA seqDB search
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQSMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQAISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGYPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAEQMTTREKKVLEAGMGKVTSASFGEESTPGQTKSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATLDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TLLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaccggccaggattccaccacaaccaggcagcgaagaagtaggcagaacccc
cagtcgccccctcaggactccagtgtcacttcgaagcgaaatattaaaaagggagccgtt
ccccgctctatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaagctcggc
caagcaatggaagaagacctaatcgtgggactgcaagggatggatctgaaccttgaggct
gaagcactggctggcactggcttggtgttggatgagcagctaaatgaattccattgcctc
tgggatgacagcttcccagaaggccctgagcggctccatgccatcaaggagcaactgatc
caggagggcctcctagatcgctgcgtgtcctttcaggcccggtttgctgaaaaggaagag
ctgatgttggttcacagcctagaatatattgatctgatggaaacaacccagtacatgaat
gagggagaactccgtgtcctagcagacacctacgactcagtttatctgcatccgaactca
tactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtcctgggg
gctgagatccggaatggcatggccatcattaggcctcctggacatcacgcccagcacagt
cttatggatggctattgcatgttcaaccacgtggctgtggctgcccgctatgctcaacag
aaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaaggaaca
cagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctacgagcag
ggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggccaaggc
caaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactacatt
gctgctttcctgcacgtcctgctgccagtcgccctcgagttccagcctcagctggtcctg
gtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgccactccg
gcagggttcgcccagctaactcacctgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaacctccgcgccctggctgaaggcgtcagtgcttcgctccac
acccttctgggagacccttgccccatgctggagtcacctggtgccccttgccggagtgcc
caggcttcagtttcctgtgctctggaagcccttgagcccttctgggaggttcttgtgaga
tcaactgagactgtggagagggacaacatggaggaggacaatgtagaggagagcgaggag
gaaggaccctgggagccccctgtgctcccaatcctgacatggccagtgctacagtctcgc
acagggctggtctatgaccaaagtatgatgaatcactgcaacttgtgggacagccaccac
ccagaggtaccccagcgcatcttgcggatcatgtgccgtctggaggagctgggccttgcc
gggcgctgcctcaccctgacaccgcgccctgccacagaggctgagctgctcacctgtcac
agtgctgagtacgtgggtcatctccgggccacagagaaaatgaaaacccgggagctgcac
cgtgagagttccaactttgactccatctatatctgccccagtaccttcgcctgtgcacag
cttgccactggcgctgcctgccgcctggtggaggctgtgctctcaggagaggttctgaat
ggtgctgctgtggtgcgtcccccaggacaccacgcagagcaggatgcagcttgcggtttt
tgctttttcaactctgtggctgtggctgctcgccatgcccaggctatcagtgggcatgcc
ctacggatcctgattgtggattgggatgtccaccacggtaatggaactcagcacatgttt
gaggatgaccccagtgtgctatatgtgtccctgcaccgctatgatcatggcaccttcttc
cccatgggggatgagggtgccagcagccagatcggccgggctgcgggcacaggcttcacc
gtcaacgtggcatggaacgggccccgcatgggtgacgctgactacctagctgcctggcat
cgcctggtgcttcccattgcctacgagtttaacccagaactggtgctggtctcagctggc
tttgatgctgcacggggggacccgctggggggctgccaggtgtcacctgagggttatgcc
cacctcacccacctgctgatgggccttgccagtggccgcattatccttatcctagagggt
ggctataacctgacatccatctcagagtccatggctgcctgcactcgctccctccttgga
tacccaccacccctgctgaccctgccacggcccccactatcaggggccctggcctcaatc
actgagaccatccaagtccatcgcagatactggcgcagcttacgggtcatgaaggtagaa
gacagagaaggaccctccagttctaagttggtcaccaagaaggcaccccaaccagccaaa
cctaggttagctgagcagatgaccacacgagaaaagaaggttctggaagcaggcatgggg
aaagtcacctcggcatcatttggggaagagtccactccaggccagactaagtcagagaca
gctgtggtggccctcactcaggaccagccctcagaggcagccacagggggagccactctg
gcccagaccatttctgaggcagccattgggggagccatgctgggccagaccacctcagag
gaggctgtcgggggagccactctggaccagaccacctcagaggagactgtgggaggagcc
attctggaccagaccacctcagaggatgctgttgggggagccacgctgggccagactacc
tcagaggaggctgtaggaggagctacactggcccagaccacctcggaggcagccatggag
ggagccacactggaccagactacgtcagaggaggctccagggggcaccgagctgatccaa
actcttctagcttcgagcacagaccaccagacccccccaacctcacctgtgcagggaact
acaccccagatatctcccagtacactgattgggagtctcaggaccttggagctaggcagc
gaatctcagggggcctcagaatctcaggccccaggagaggagaacctactaggagaggca
gctggaggtcaggacatggctgattcgatgctgatgcagggatctaggggcctcactgat
caggccatattttatgctgtgacaccactgccctggtgtccccatttggtggcagtatgc
cccatacctgcagcaggcctagacgtgacccaaccttgtggggactgtggaacaatccaa
gagaattgggtgtgtctctcttgctatcaggtctactgtggtcgttacatcaatggccac
atgctccaacaccatggaaattctggacacccgctggtcctcagctacatcgacctgtca
gcctggtgttactactgtcaggcctatgtccaccaccaggctctcctagatgtgaagaac
atcgcccaccagaacaagtttggggaggatatgccccacccacactaa

DBGET integrated database retrieval system