KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153312Help
Entry
101153312         CDS       T02442                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ggo01100  Metabolic pathways
Module
ggo_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101153312 (B3GALT1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     101153312 (B3GALT1)
Glycosyltransferases [BR:ggo01003]
 Glycan extension
  Type 1 chain
   101153312 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 101153312
NCBI-ProteinID: XP_004032783
Ensembl: ENSGGOG00000008115
UniProt: Q7JK24
LinkDB All DBs
Position
2B
AA seq 326 aa AA seqDB search
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcctgtttgtatgttttgacagttgtgtgctgggccagcgctctc
tggtacttgagtataactcgccctacttcttcttacactggctccaaaccattcagccac
ctaacagttgccaggaaaaacttcacctttggcaacataagaactcgacctatcaaccca
cattcttttgaatttcttatcaacgagcccaataaatgtgagaaaaacattccttttctt
gttatcctcatcagcaccactcacaaggaattcgatgcccgtcaggcaatcagagagacg
tggggggatgagaacaactttaaggggatcaagatagccaccctgttcctcctgggcaag
aatgctgatcctgttctcaatcagatggtggagcaagagagccaaatcttccatgatatc
atcgtggaggactttattgactcctaccataaccttaccctcaaaacattaatggggatg
agatgggtggccactttttgttcaaaagccaagtatgtcatgaaaacagacagcgacatt
tttgtaaacatggacaatcttatttataaattactgaaaccctccaccaagccacgaaga
aggtattttactggctatgtcattaatggaggaccgattcgggacgtccgcagtaagtgg
tatatgcccagggatttgtacccagacagtaactacccacctttctgttcggggactggc
tacatcttttcagccgatgtggctgaactcatttacaagacctcactccacacaaggctg
cttcaccttgaagacgtatatgtgggactgtgtcttcgaaagctgggcatacatcctttc
cagaacagtggcttcaatcactggaaaatggcctacagtttgtgtaggtatcgccgagtt
atcaccgtgcatcagatctctccagaagaaatgcacagaatctggaatgacatgtcaagc
aagaagcatctcagatgttag

DBGET integrated database retrieval system