KEGG   Gossypium hirsutum (upland cotton): 107927040Help
Entry
107927040         CDS       T04793                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ghi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107927040
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107927040
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107927040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 167 aa AA seqDB search
MSAGIFASPIAGSGFVGLKTNVTKLVPTNGSISWSRKTVSNGSRTHCMKTWNPINNKKFE
TLSYLPPLSDDSIAKEIDYMMKKGWIPCLEFDEVGAVHRENSSIPGYYDGRYWTLWKLPM
FGCNDSSQVLKEIHECKKAYPNAYIRCLAFDNKHQAQCMSFVIHKPN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccggaatctttgcatcaccaatcgctggttctggttttgttggcctgaaaacc
aatgttacaaagctggttccaactaatggttctatttcatggagccggaaaactgtgtcc
aatggttcaagaacccactgcatgaagacatggaatccaatcaacaacaagaagtttgag
acgctttcttaccttccacctctctcagatgactcgattgcaaaggaaattgattacatg
atgaaaaaagggtggattccttgtcttgaatttgatgaggtgggggctgtccacagggag
aatagcagcattccagggtactatgatgggaggtattggactctatggaagctgccgatg
tttgggtgcaacgactcttctcaagtcctgaaagaaattcacgagtgcaaaaaggcatac
cccaatgcttatatccgttgcctggcatttgacaacaagcaccaagctcagtgcatgtcc
tttgtcattcacaaacctaactga

DBGET integrated database retrieval system