KEGG   Gossypium hirsutum (upland cotton): 107941224Help
Entry
107941224         CDS       T04793                                 

Definition
(RefSeq) multifunctional non-homologous end joining protein LigD-like
Organism
ghi  Gossypium hirsutum (upland cotton)
SSDB OrthologParalogGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DUF4265
Motif
Other DBs
NCBI-GeneID: 107941224
NCBI-ProteinID: XP_016730267
UniProt: A0A1U8MTV7
LinkDB All DBs
Position
Unknown
AA seq 850 aa AA seqDB search
MAGAAEELLKTYREKRDFSKTKEPSGGAASLEGLVFCVQKHDATRLHYDFRLEWEGVLKS
WAVTRGPSLDPADKRLAVRTEDHPMDYGDFEGSIPEGEYGGGTVMLWDFGRWSPREDMAE
GLAKGSIKMELAGEKMKGHWALVRMKPRGRERRENWLLIKEKDDFASSRRDILRQDRSVK
TGRTLNQIAKGDEVWTRRTKRPEPVAREQTLEKGDPGGGAREKRSSPGKLPRFRALQLAT
LVDEAPTGRDWLHEMKYDGYRVLIATGGGEVRLWTRNELDWTDRFGAIRPAVEALPCRSA
LIDGEIVAFDAKGRTDFSSLQAALSDGGALSCFAFDLLELDGEKLTDRPLVERKEKLEAL
IARAGEGSLLYSQHVRGSGPAVFEKICASGLEGIVSKRADAPYRPGRGGAWVKTKCTKRQ
EFVIGGFSPSDKKGRPFSSILLGVREGDRLVYRGRVGSGFTEDSLDDLGRRFASLTRKTS
PFADLPRAIVRTSTFVEPKLVAEIDFAELTGEGAVRHGVFKGLREDKAAEAVADETPVKA
SNPPAGRRTKGDGSPIEIAGVRLTSPDRVVFPSQGLTKGDLARYYEAVAERMLAHAGGRP
LSLVRCPQGRTKACFFQKHDTGGFPDAIGHVDVTEKDGEKAVYLTVTDAAGLIAALQMNT
LEFHIWGSRNDRLEHPDRLVFDLDPDEGLSFADVRQAAFDLRDRLADAGLTTFPLVTGGK
GVHLVAPLSRRQDWSVVKGFARALAQTLEAEEPARFVSTMSKAKRKGRIFVDWLRNDRGQ
TAIAPYSTRSREGAPIATPVSWEEFGALKAANLFHPADILRRTEAADPWAAYGTVRQSIT
AKARKRFEAE
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcggcggaagagcttctcaagacctatcgcgagaaacgcgacttctcgaag
acgaaggagccgtccggcggagccgcctcgctcgagggtctcgtcttctgcgttcagaag
cacgacgcgacgcggctccactacgattttcggctcgaatgggaaggcgtgctgaagagc
tgggccgtgacgcgcggcccgagcctcgatccggccgacaagcgtctggccgtgcggacc
gaagaccatccgatggactatggtgacttcgagggctcgattcccgagggcgagtatggc
ggcggcaccgtcatgctgtgggatttcggccgctggtccccgcgcgaggacatggccgaa
gggctcgccaagggctccatcaagatggagctcgccggcgagaagatgaaaggccattgg
gcgctcgtgcgcatgaagccgcgcggccgcgaacgccgcgagaactggcttctcatcaag
gagaaggacgacttcgcctcgagccgccgtgacatcctgcgacaggaccgcagcgtcaag
accggccgcacgttgaaccagatcgcgaagggcgacgaggtctggacgcggcgcacgaag
cgccccgagcccgtggcgcgggagcagacgctcgagaaaggcgatcccggcggcggcgcg
cgggagaagcgttcctcccccggcaagcttcctcgcttccgggcgctccaactcgcgacg
ctcgtcgacgaggcgcccaccggccgggactggcttcacgagatgaagtacgacggctac
cgcgttctgatcgcgaccggcggcggcgaagttcgcctctggacgcgcaacgaactggac
tggacggatcgcttcggcgcgatccgtcccgcggtcgaggccctgccatgccgctccgcg
ctgatcgatggcgagatcgtcgccttcgatgcgaagggccgcaccgacttctcatcgctg
caggcggctctctcggacgggggcgccctttcctgcttcgccttcgaccttctggaactc
gacggcgagaagctgaccgaccgcccgctcgtggagcggaaggaaaagctggaggctctg
atcgcgagagcgggcgagggatcgctcctctacagccagcatgtgcgcggttcggggccg
gcggtcttcgagaagatctgcgcatcggggctggaggggatcgtctccaagcgcgcggac
gcgccatatcgcccgggccgcggcggcgcctgggtgaagaccaagtgcaccaagcggcag
gagttcgtgatcggcggcttctccccgtccgacaagaagggccggccgttctcctccatt
ctcctcggcgtccgggagggcgaccggctggtctatcgcgggcgtgtcgggtccggcttc
accgaggacagcctggacgatctggggcggcgcttcgcgagtctgacgcgcaagacctcc
cccttcgcggacctgccgcgcgcgatcgtgcggacctcgaccttcgtggagccgaagctc
gtcgccgagatcgacttcgcggagctgacaggcgaaggcgcggtgcggcacggcgtcttc
aagggcctgcgcgaggacaaggcggccgaggcggtggcggacgagacgccggtcaaggcc
tcgaacccgccggcgggccgccgaacgaagggcgacggctcgccgatcgagatcgcaggc
gttcggctgacctcccccgaccgcgtcgtgttcccgagccagggcctgaccaagggcgat
ctcgcccgctactacgaggcggtggccgagcgcatgctcgcccatgcgggcgggcggcct
ttgtccctcgtgcgctgcccgcaggggcgcacgaaggcctgcttcttccagaagcacgac
acgggcggtttcccggacgcgatcggccatgtcgacgtgaccgagaaggacggcgagaag
gccgtctatctgaccgtcacggacgccgccggcctcatcgccgccttgcagatgaacacg
ctggagttccacatctggggctcgcgcaacgaccggctggagcacccggaccggctcgtc
ttcgatctcgatcccgacgagggcctgtccttcgcggacgtgcggcaggccgcgttcgac
cttcgcgacaggctcgccgacgcagggctgacgacctttccgctggtgaccggcggcaag
ggcgtccatctcgtcgccccgctctcgcgtcgccaggactggtcggtggtgaagggtttc
gcgcgggccctcgcgcagacgctggaggcggaggagccggcgcgcttcgtctccaccatg
tcgaaggccaagcgaaaggggcgcatcttcgtcgactggctgcgcaacgatcgcggccag
accgcgatcgcaccctattccacgcgctctcgcgagggagccccgatcgccacccccgtc
tcgtgggaggaattcggcgcgctgaaggccgcgaacctcttccacccggccgacatcctg
cggcggaccgaagccgccgacccatgggcggcgtacggcacggtccgccagtcgatcacc
gcgaaggcgaggaaacggttcgaggcggagtga

DBGET integrated database retrieval system