KEGG   Gossypium hirsutum (upland cotton): 107962718Help
Entry
107962718         CDS       T04793                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ghi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107962718
   00051 Fructose and mannose metabolism
    107962718
   00052 Galactose metabolism
    107962718
   00500 Starch and sucrose metabolism
    107962718
   00520 Amino sugar and nucleotide sugar metabolism
    107962718
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107962718
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107962718
Membrane trafficking [BR:ghi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107962718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
11
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRIKSSGKWARALSILTEFEEKCGTPSSKLKQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESR
VVKQEFEEVSIPPHLMTGSSDELFDYIASALAKFVATESDSQHVSPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFSVEDTVGQDVVGELTKAIERAGLDMRVAALVNDTVGTLAGGRY
NNPDVAAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDAGSLNPGEQIFEKMISGMYLGEIVRRVLCKMAEEAAIFGDAVPPKLKIPFILRTPHT
SAMHHDTSPDLKVVATKLKDILEISNTSLKLRKLIVEVCDIVATRGARLSAAGIVGILKK
LGRDTVKDGEKQKSAVALDGGLYEHYTKFRTCMENTLWELLGEEASENIAVEHSMDGSGI
GAALLAASHSQYIEVEEP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtggcagtaggggcggcggtggtgtgcgcggcggctgtgtgtgcagcagcg
gcgctggtggtgcgtcacaggataaagagttcggggaagtgggcccgggcgttgtctata
ctgacggagtttgaggaaaagtgtgggaccccaagttcgaagcttaaacaggtggctgat
gccatgaccgttgagatgcacgccgggctcgcatcagagggtggcagcaagctcaagatg
atcatcagctatgtagataatcttcccactggtgatgagaaagggctgttttatgccctt
gaccttggtggcacaaatttccgtgttctgcgtgtacacttaggtggtaaagaaagccgt
gttgttaagcaggaatttgaggaagtttcaattcctccgcatttgatgacgggatcttca
gatgaattatttgattacattgcttcagctcttgcaaaatttgttgctacggaaagtgac
agtcaacatgtttcacctggtagacaaagggagctggggttcactttctcatttcctgtt
aggcaaacatcaatatcatcagggactcttataaaatggacaaagggcttctcagtagaa
gatacagttggacaagatgttgttggagaattgaccaaagcaatcgaaagggctggcctt
gacatgcgtgttgcagctttggtcaatgatacagtcggcacattggctggtggtagatac
aacaacccagatgttgctgctgccgtgatattaggtactggcacaaatgcagcttatgta
gagcgcgcccatgcaatccccaaatggcacggtcttctacctaaatcgggggagatggtt
atcaacatggaatggggtaactttcggtcttcacaccttccactaacagaatatgaccaa
gcacttgatgctgggagtctaaaccctggagaacagattttcgagaaaatgatatctggt
atgtatttgggagagattgtacgtagagttttgtgcaagatggctgaagaagctgccatt
tttggtgatgctgtcccaccaaagttgaaaattcctttcatacttagaacccctcacaca
tctgcaatgcatcatgacacatctccagatttgaaagtggtcgccaccaaacttaaggat
atattggagatatcaaatacctctttgaaattgaggaagcttattgttgaggtgtgtgac
attgttgctactcgtggtgctcgcctatctgctgctggaatcgtaggtatcctcaagaaa
ttaggaagagacacagtgaaagatggcgaaaagcagaagtcagcggtagctttagacggc
gggttgtatgagcactacactaaattcaggacctgcatggagaacaccctctgggaattg
ctaggagaagaagcctccgagaacattgctgttgagcactccatggatgggtctggcatt
ggggcagccctcctggcagcctctcactcccaatacattgaagttgaggaaccctga

DBGET integrated database retrieval system