KEGG   Gossypium hirsutum (upland cotton): 107962718Help
Entry
107962718         CDS       T04793                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi00051  Fructose and mannose metabolism
ghi00052  Galactose metabolism
ghi00500  Starch and sucrose metabolism
ghi00520  Amino sugar and nucleotide sugar metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Module
ghi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ghi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ghi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107962718
   00051 Fructose and mannose metabolism
    107962718
   00052 Galactose metabolism
    107962718
   00500 Starch and sucrose metabolism
    107962718
   00520 Amino sugar and nucleotide sugar metabolism
    107962718
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107962718
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107962718
Membrane trafficking [BR:ghi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107962718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1731 Sir1
Motif
Other DBs
NCBI-GeneID: 107962718
NCBI-ProteinID: XP_016754690
UniProt: A0A1U8PU71
LinkDB All DBs
Position
11
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRIKSSGKWARALSILTEFEEKCGTPSSKLKQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESR
VVKQEFEEVSIPPHLMTGSSDELFDYIASALAKFVATESDSQHVSPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFSVEDTVGQDVVGELTKAIERAGLDMRVAALVNDTVGTLAGGRY
NNPDVAAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDAGSLNPGEQIFEKMISGMYLGEIVRRVLCKMAEEAAIFGDAVPPKLKIPFILRTPHT
SAMHHDTSPDLKVVATKLKDILEISNTSLKLRKLIVEVCDIVATRGARLSAAGIVGILKK
LGRDTVKDGEKQKSAVALDGGLYEHYTKFRTCMENTLWELLGEEASENIAVEHSMDGSGI
GAALLAASHSQYIEVEEP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtggcagtaggggcggcggtggtgtgcgcggcggctgtgtgtgcagcagcg
gcgctggtggtgcgtcacaggataaagagttcggggaagtgggcccgggcgttgtctata
ctgacggagtttgaggaaaagtgtgggaccccaagttcgaagcttaaacaggtggctgat
gccatgaccgttgagatgcacgccgggctcgcatcagagggtggcagcaagctcaagatg
atcatcagctatgtagataatcttcccactggtgatgagaaagggctgttttatgccctt
gaccttggtggcacaaatttccgtgttctgcgtgtacacttaggtggtaaagaaagccgt
gttgttaagcaggaatttgaggaagtttcaattcctccgcatttgatgacgggatcttca
gatgaattatttgattacattgcttcagctcttgcaaaatttgttgctacggaaagtgac
agtcaacatgtttcacctggtagacaaagggagctggggttcactttctcatttcctgtt
aggcaaacatcaatatcatcagggactcttataaaatggacaaagggcttctcagtagaa
gatacagttggacaagatgttgttggagaattgaccaaagcaatcgaaagggctggcctt
gacatgcgtgttgcagctttggtcaatgatacagtcggcacattggctggtggtagatac
aacaacccagatgttgctgctgccgtgatattaggtactggcacaaatgcagcttatgta
gagcgcgcccatgcaatccccaaatggcacggtcttctacctaaatcgggggagatggtt
atcaacatggaatggggtaactttcggtcttcacaccttccactaacagaatatgaccaa
gcacttgatgctgggagtctaaaccctggagaacagattttcgagaaaatgatatctggt
atgtatttgggagagattgtacgtagagttttgtgcaagatggctgaagaagctgccatt
tttggtgatgctgtcccaccaaagttgaaaattcctttcatacttagaacccctcacaca
tctgcaatgcatcatgacacatctccagatttgaaagtggtcgccaccaaacttaaggat
atattggagatatcaaatacctctttgaaattgaggaagcttattgttgaggtgtgtgac
attgttgctactcgtggtgctcgcctatctgctgctggaatcgtaggtatcctcaagaaa
ttaggaagagacacagtgaaagatggcgaaaagcagaagtcagcggtagctttagacggc
gggttgtatgagcactacactaaattcaggacctgcatggagaacaccctctgggaattg
ctaggagaagaagcctccgagaacattgctgttgagcactccatggatgggtctggcatt
ggggcagccctcctggcagcctctcactcccaatacattgaagttgaggaaccctga

DBGET integrated database retrieval system