KEGG   Gekko japonicus: 107108039Help
Entry
107108039         CDS       T04299                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5-like
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
gja  Gekko japonicus
Brite
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107108039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 964 aa AA seqDB search
MVGKLAAEELQASLDPLQQSGFKPGPEPSGSTGQLVKDPVQKRSFWKPRKRECPVQNPSA
LRRQPALPSLIMEQERHLKCKRASRHSRGKSGFHLSPPSWLSPPARSICLCGLRQQCAWQ
PPPPPPDSPSPASNRLQAKSESDHRAPFPGGLAGGSHERTWLDRSLLPESESTSSARQAG
AQVDCHPRREVQGCQPFLNTRRWQRGKPSFHQAFLGAYSVNTCQAGRESVRARRAATAAP
LPSESGPRCQEASGGVSGQVPQPCPRGHTPASVCPGSCHPVPPRGTRRRKRSGAGSWPQG
PQPERQAGTRAVFLLELGEPEARGAWSAGYVSNGPRSTDVAVLAPAGAPIGRYQLKIHLD
SGYGQAASYLLGEFVLLFNAWCPEDEVYLASEPERQEYVMSEDGILYQGNQDWIQPSPWN
YGQFEEDLVDICLELLDRSLNYRGNPARDCSLRGSAVYVSRVLSAMVNSNDDNGVLLGNW
SEDYSGGVRPTQWSGSVAILQRWHRAGGQPVRYGQCWVFAAVMCTVMRCLGIPARVVTNF
NSGHDTDGNLIIDVFYDKTGQLLPRESKDSVWNFHVWNECWMARRDLPVGYGGWQVLDAT
PQERSDGLYRCGPAPVAAIREGDVQHRYDAPFVFSMVNADRVAWLLSGGRREKLHWDKSS
IGIHISTKRVGSQDREDITGTYKHAEGRGSDLRAPSQLCHTSSMGTPPAEALKARRGAEA
VPAATDSEARFSATAAGSSLVPPPEAPLSLQLRLVESAEIGQDIHLMLLAQNLELAPKEM
KLSLSAQPVLHDGTPRPPFWQDTHYLSLRPKEEKRISWRIAYGQYGQHLWEDRQVEVIAI
AEENASWQKTLAEKTITLANPSLTISVLAPVVESHPFPLHVEFVNPLPRPVGGCGLLVEG
GGLVKGQASIELGSLQAQEKGGIKFQLTPYKSGLRQLHVTLTSSQFPPIKGWKRLEVAPR
PGGS
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaaaactggctgcagaggagctccaggcctccctggacccgttgcagcagtcc
ggtttcaagccaggcccagagccctctggcagcacagggcagctggtgaaggatcctgta
cagaaaaggtctttctggaagccccggaaacgggaatgcccggtgcagaacccttctgcc
ctgcggaggcagccagcccttccctccttgatcatggagcaggagaggcatttgaagtgc
aaacgggcatctcggcactccaggggcaagagcggcttccacctgagccctccttcctgg
ctttctccgcctgcacggagcatctgcctctgcgggctcaggcagcagtgcgcttggcag
cctccgccgccgccacccgacagtccctcacctgccagcaaccgtctgcaggccaagtcg
gagagcgaccaccgagcgccctttcctggcgggctggcgggtggatcccacgagcggacc
tggctggaccggtctctcctgccggagagcgagtccacctcttcagcgaggcaggcgggg
gcgcaggtggactgccaccctcggcgggaagtgcaaggatgccagcccttcctgaacacc
aggcgctggcaaagagggaagccaagtttccatcaggctttcctgggcgcctactccgtc
aacacctgccaggctgggcgggagagcgtcagagccaggcgtgctgccaccgccgctcct
ctgccctccgagagcgggccccggtgccaggaagcctctgggggagtgagcgggcaggtg
ccccagccatgcccccggggccacacccccgcctccgtctgccctggctcctgccacccg
gtgccgccccgaggcactcggaggaggaagaggagcggagcgggatcatggcctcagggc
ccccagccggagcggcaggctggcacccgagccgtcttcctcctggagctgggggagccc
gaggccaggggcgcctggagcgccggctacgtctccaacggcccccggtccacagacgtg
gcggtgctggcgccagccggggcccccatcgggcgctaccagctcaagatccacctggac
tccggctacggccaggcggcctcttatctcctgggggagtttgtcttgctcttcaacgcc
tggtgcccagaggacgaggtgtacctggcgagtgagcctgagcggcaggaatacgtcatg
agcgaggacggcatcctctaccaaggcaaccaggactggatccagccctccccctggaat
tacgggcagtttgaggaagacctcgtggacatctgcttggaactcctggaccggagcttg
aactaccggggcaacccagccagggactgctccctgcgcggcagcgcggtctacgtcagc
cgggtgctgagtgccatggtcaacagcaacgatgacaacggggtcctgctgggcaactgg
agcgaagactattctgggggggtccgcccgacccagtggagcggcagcgtggctatcctg
cagcggtggcaccgggcgggtggccagccggtcagatacgggcagtgctgggtcttcgcg
gctgtgatgtgcacagtgatgcggtgccttgggatcccagcccgtgtggtgaccaatttc
aactcggggcacgacacagacgggaacctgattatcgacgtcttctatgacaagacgggc
cagctcctgccccgcgagagcaaggacagtgtctggaacttccacgtgtggaacgagtgc
tggatggcgcggagagacctgccggtggggtacggtggctggcaggtgttggatgcaacc
ccccaggagcgcagtgacgggctgtaccgctgtggcccagcccccgtcgcggccatccgg
gaaggagatgtgcagcaccgctacgacgccccctttgtgttctcgatggtgaacgcggac
cgtgtggcttggctgctctctggggggaggagggagaagctgcactgggacaagagctcc
atcgggatccacatcagcaccaaacgagtcgggagtcaggaccgagaggacatcaccggc
acctacaagcatgcggaaggacggggcagtgacctgagggcacccagccagttgtgccac
accagctccatgggcacgccacctgctgaggccctgaaggccaggaggggggcagaggct
gtgcccgcggccacagactccgaggcaaggttctctgctacggcagccggcagcagcttg
gtgccacccccagaagccccgctctccctccagctccggctggtggagagtgccgagatt
gggcaggacatccacctgatgctgctggcgcagaacctggagctggcccccaaggagatg
aagctgagcctgagtgcccagccggtgctgcacgacggcaccccccggccccccttctgg
caggacacccactacctctccctccgccccaaggaagagaagcgcatctcctggcgcatc
gcctacgggcagtacgggcagcacctgtgggaggaccggcaggtcgaggtcatcgccatc
gccgaggagaacgcctcctggcagaagacgctggcggagaagaccatcactctggccaac
ccctccctcaccatcagcgtcttggcgccggtggtggagagccatcctttcccgctgcac
gtggagttcgtcaaccccctgccccggccggtgggcggctgcggcttgctcgtggaaggc
ggcgggctggtgaagggccaggcctcgatcgagttgggctccctccaggcccaggaaaaa
ggcggcatcaagttccagctgacaccctataagagcggcctgcggcagctgcacgtcacc
ctcacgagcagccaattcccccccatcaagggctggaagcggctggaggtggccccccgc
ccaggcggcagctag

DBGET integrated database retrieval system