KEGG   Gekko japonicus: 107114311Help
Entry
107114311         CDS       T04299                                 

Definition
(RefSeq) putative hexokinase HKDC1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
gja  Gekko japonicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107114311
   00051 Fructose and mannose metabolism
    107114311
   00052 Galactose metabolism
    107114311
   00500 Starch and sucrose metabolism
    107114311
   00520 Amino sugar and nucleotide sugar metabolism
    107114311
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107114311
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    107114311
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107114311
Membrane trafficking [BR:gja04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107114311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 889 aa AA seqDB search
MRLSDDVLLDVMKRFQAEMVKGLGRDTNPTATLKMLPTFVRSTPDGSEKGDFLALDLGGS
KFRVLKVKVSEDGKQNVQMESQFYPTPKEIIHGNGTDLFKYVAECLTDFMETKDIKHKKL
PLGFTFSFPCRQNKLEEGVLLSWTKHFKVRGVQQTDVVSSLRKALRKHQDIDVDVLALVN
DTVGTMMTCGYDDQRCEVGVIIGTGTNACYMEEMSNIDLVEGDEGRMCINTEWGAFADDG
SLEGIRTEFDREIDLGSINPGKQLFEKMISGLYLGELVRLILLKMAKEGLLFNGKLSTDL
CTKGKIETRHVAAMEKYKEGLNNTKEILTELGLTPSEEDCLAVQHVCTIVSFRSANLCAS
ALAAILTRLRENKKLIRLRTTVGMDGTVYKTHPQYAKRLHKVVRRLVPNCDVRFLLSESG
SGKGAAMVTAVAYRLLSQRKQIDEVLAYFRLTEEDLVEVKNKMRLELERGLKKEMQPTAT
VKMLPTFVCGTPDGTEKGKFLALDLGGTNFRVLLVKIRSGRSKSVRMYNKIFAIPMEIMQ
GTGEELFDHIVQCIAEFLEYMGIKGARLPLGFTFSFPCRQASIDKGALIGWTKGFKATDC
EGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMMTCGYEDPNCEIGLIAGTGSNVCYME
NMKNIEVIKEDEGRMCINTEWGGFGDNGCINHLRTKYDKEVDEGSLNPGKQRYEKMTSGM
YLGEIVRQILIDLTKQGLLFRGQISETLRSRGIFETKFLSQIESDRLALLQVRKILQQLG
LDSTCDDSITVKEVCGCVSKRAAQLCGAGLAAVVEKIREDRNLEHLKTTVGVDGTLYKLH
PHFSRILQETVKQLAPQCDVTFLLSEDGSGKGAALITAVAKRMHSAAEH
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctctctgatgatgtcctactggatgtgatgaaacgcttccaggcagagatggtg
aagggcctgggaagagacaccaacccaacagctaccttaaaaatgctcccaacatttgtg
cgatcaactcctgatggctcggaaaagggtgacttcctggctttagaccttggtggctcc
aaatttagggtcctgaaggtcaaagtgtccgaagatgggaagcaaaacgttcaaatggag
agtcagttctacccaacacccaaagaaatcatacatgggaatggaacagatctgtttaaa
tatgtagctgagtgtctcacagacttcatggagaccaaggacataaagcacaagaagttg
cctctcggctttaccttttcttttccttgtaggcagaataaattagaggagggtgtgctg
ctttcttggacaaaacactttaaagtccgaggagtgcagcagacagatgtggtgagctcc
ctccgcaaagccctcaggaaacaccaggacattgatgtggatgtcctcgccttggtaaat
gacacagtgggaacaatgatgacctgtggatatgatgatcaacggtgtgaagttggtgtc
attattggaacaggcacgaatgcttgctacatggaggagatgagcaatattgaccttgtg
gaaggtgatgaagggcgaatgtgcatcaacactgaatggggagcctttgcagatgacggc
tcattagaaggcattcggactgagttcgacagagagattgatttaggttctattaatcct
gggaagcaattatttgagaagatgatcagtggattgtatttaggtgaacttgtcaggctt
atccttctgaaaatggcaaaggaaggcttacttttcaatgggaagttatcaacggatctc
tgcactaagggcaagattgagacgagacatgttgctgccatggaaaaatataaagaaggc
ctgaataatactaaagagattctgacggaactgggcctgaccccgtctgaagaagactgc
cttgcagtacagcacgtctgcaccattgtttcgttccgttcggccaacctttgtgcctca
gccttagcggccatcctgacgcgccttcgtgaaaataaaaaactgattaggctccgtacg
actgttggcatggatggaacagtgtacaagacacaccctcagtatgctaagcgtcttcat
aaagtagtcagaaggttagtccccaactgcgatgttcggtttttgctctccgagagtggc
agcgggaaaggagctgcaatggtaaccgctgttgcctacaggctgttatcacagcgtaaa
cagatcgatgaggtcttggcatacttcagattaactgaagaggacctcgtagaagtgaaa
aacaaaatgaggctggagctggagcgtggcctgaagaaagagatgcagccaacggcgacg
gtgaaaatgctgccaacgtttgtctgcggaactccagatgggacagaaaaaggaaaattc
cttgctctagatcttgggggaacaaatttcagagttttgcttgtaaaaatcagaagtgga
agaagcaaatcggtccgaatgtacaataaaatctttgccattcctatggaaattatgcaa
ggaacaggggaagagctgtttgatcatattgttcagtgcatcgcagagtttttggagtat
atgggcattaaaggtgcacgactccctcttggctttacattttctttcccctgcaggcaa
gcaagcattgataagggggctctcattggctggacaaagggttttaaggccacagactgt
gaaggagaagatgttgttgacatgctcagagaagctattaaacgccgaaatgaatttgat
ctggatattgtggccattgtcaatgacactgttgggaccatgatgacttgtggttatgaa
gacccaaactgtgaaattggtctcattgcagggacaggcagtaatgtgtgctacatggaa
aacatgaagaatatcgaagttatcaaagaggatgaaggcaggatgtgcatcaatacagaa
tggggaggatttggtgacaacggctgcattaatcatctcaggacaaaatatgacaaagaa
gtagatgaaggttcattaaaccctgggaaacagaggtatgagaagatgaccagcggaatg
tatctgggtgaaatagtgaggcagattttgattgacttgacgaagcaaggccttctcttc
agaggtcagatttcagaaacgctgagaagcagaggaatatttgaaaccaaattcctgtct
cagattgaaagtgaccggcttgccttgctccaagtgagaaaaatcctgcagcagcttggc
cttgacagcacctgtgacgacagtatcaccgtgaaggaggtgtgcggctgtgtttcgaag
agagcagctcagctctgtggagccggactggcggcggttgtcgagaagatacgggaggac
aggaacttggagcacctaaaaaccaccgtaggcgtggatggcaccttatacaagctgcat
cctcatttttctaggattctgcaagaaactgtgaaacagctggcgccccagtgtgatgtg
actttcctgctttcagaagacgggagtggaaagggagctgccctaattactgctgttgcc
aagaggatgcatagcgccgctgagcactga

DBGET integrated database retrieval system