KEGG   Gekko japonicus: 107114882Help
Entry
107114882         CDS       T04299                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
gja  Gekko japonicus
Brite
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107114882
Cell adhesion molecules and their ligands [BR:gja04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     107114882
   VLA-9
     107114882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 620 aa AA seqDB search
RYPQQNKGTYIQVPLVSELESGKWGAKITQNENNSVSLTILSAPNCIVGKFRMYVAVLTP
YGILRTKRNPDTDTYIIFNPWCAEDAVFLDDERERQEYVLNDLGMIFYGDPDNIRTRSWN
YGQFEEGVLDACLYLMDQAKLDLSGRGNPVKISRVGSAVINSQDDQGVLVGSWSNVYDYG
VAPSAWTGSVDILLDYYSSKEPVRYGQCWVFAGVFNTFLRCIGIPARVITNYSSAHDNDA
NLQLDVFLDEESKVDNKLTKDSIWNYHCWNEAWMARPDLPVGFGGWQAVDSTPQENSDGM
YRCGPASVQAIKHGHVCFQFDSPFIFAEVNSDVVYSNVMTNGKKEVKYIDKTHIGKLILT
KALGTDEKMDVTETYKFKEGTEEERLALDTALMYGVKKVAQDVLPSAEVDMDFQVEDSTI
GSDFKVNITFRNNTQNRYTVKSYLSGNIVFYTGVSKTEFKNHSFDVTLEPAKTQTTEVLI
KASEYMSRLLEQASLHFFVTARVNETQKILAKQKSAALKIPQVLLKVPGEKVVGKEMTVI
VEFTNPLNRELTDVLVRLDGPGLLRPTSKKFRNLSKNSTLTWEEKCIPKRAGLRKLIASL
NCDAIRHVYGELDIDIQSAA
NT seq 1865 nt NT seq  +upstreamnt  +downstreamnt
ggcgatatccccaacaaaacaaaggcacgtacattcaggttcctttggttagtgagctgg
aaagtgggaaatggggagctaagatcacccagaacgagaacaactctgtcagcctgacca
tcttgtcagcaccaaactgcattgtgggaaagttccgcatgtatgtcgctgtcttgactc
catacggcattcttcggacaaaacgaaatccagacacagatacatacataattttcaacc
cctggtgtgcagaggatgctgtgttcctggatgacgagcgggaacgacaagagtacgtcc
tgaatgaccttggaatgattttctatggggaccctgacaatataagaaccaggagctgga
attatggtcagtttgaagagggtgttttggatgcttgcctgtacctgatggatcaagcaa
aactggatttgtctggccgaggaaatcctgtcaaaatcagccgggttggctctgcagtga
tcaattctcaagatgaccagggtgtgcttgtaggttcttggagcaacgtttatgactatg
gagttgcaccatcagcctggactggaagtgtagacattctgctggactactacagttcta
aagagccagtgcggtatggccagtgctgggtctttgctggagtcttcaacacttttttga
gatgcataggaattcctgcaagagttatcactaactactcctcagcccatgacaatgatg
ccaacctacagctggatgtctttttagatgaggagtcaaaggtggataataaactcacaa
aagactcaatctggaattaccattgctggaatgaggcttggatggccagacctgaccttc
ctgtcggctttggagggtggcaggctgtggacagcactccccaagaaaacagcgacggca
tgtaccggtgtggtcccgcttcagttcaagccattaaacatgggcatgtctgcttccagt
ttgattctcctttcatctttgcagaggttaacagtgatgttgtctactcgaacgttatga
caaatgggaagaaggaggttaaatatattgacaagacccacattgggaaactaattctga
ccaaggcactgggtacggatgaaaaaatggatgttactgagacctacaaattcaaagaag
gcacagaggaagaaaggctggcccttgacactgccctgatgtacggtgttaaaaaggttg
cccaggatgttttgcccagtgcagaggtcgacatggactttcaagtggaagattcgacaa
ttggcagcgacttcaaagtcaacattactttcagaaataacacccagaaccgctacactg
tgaagtcttatctttccggaaacattgtgttttatactggagtctccaagacggaattca
agaaccacagttttgacgtgacgctggaaccggcgaaaactcaaactaccgaggtgctaa
tcaaggccagcgagtacatgagccggttgctggaacaagcttccctgcatttcttcgtca
cagcccgtgtcaacgaaacacagaagatcctggccaagcagaaaagcgctgcgctaaaaa
tcccacaagtgctccttaaggttcctggtgagaaagtagtcggcaaggaaatgacagtga
tagtggaattcaccaacccgctgaatcgggaactgacagatgttttggtgcgacttgatg
ggcctggtctactgcgtcccacctcaaagaagtttagaaacctctcaaagaattcaacct
tgacctgggaagaaaaatgtattccaaagcgggccggcctccgaaagctgattgcaagcc
tgaattgtgatgccatacggcatgtctacggcgaactggacattgatattcaaagtgctg
cgtaa

DBGET integrated database retrieval system