KEGG   Gekko japonicus: 107117925Help
Entry
107117925         CDS       T04299                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gja  Gekko japonicus
Pathway
gja00480  Glutathione metabolism
gja00980  Metabolism of xenobiotics by cytochrome P450
gja00982  Drug metabolism - cytochrome P450
gja00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:gja00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    107117925 (GSTO1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107117925 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    107117925 (GSTO1)
   00983 Drug metabolism - other enzymes
    107117925 (GSTO1)
Enzymes [BR:gja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107117925 (GSTO1)
Transporters [BR:gja02000]
 Other Transporters
  Pores ion channels [TC:1]
   107117925 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 107117925
NCBI-ProteinID: XP_015275597
LinkDB All DBs
Position
Un
AA seq 242 aa AA seqDB search
MAGEFARSLGKGSAAPGPVPEGMIRLYSMRYCPFAQRTRLVLKAKGIDHEIININLKNKP
DWLFQKNPFGLVPLLETSKGQLIYESPITCEYLDEAYPEKKLYPEDPYEKAYQKMLLEFF
SQLTPVTYKYFLANRNGEDASALKEEFTKKLLKLEEILANHKTKFFGGNSVSMIDYLMWP
WFERLEAYHLHDCLNHTPTLKHWVESMQLDPAVKATITDPQTYKGYLELYVKNSPEACDY
RV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggctggggaatttgcgaggagtttagggaaaggaagtgcagctcctgggcctgtgcca
gagggaatgatccgtctctacagtatgcgctactgtccctttgcacagaggacacggcta
gtcctaaaggccaaaggaattgaccatgaaatcattaatatcaacctgaaaaacaagcca
gattggctttttcagaaaaacccatttggactagtacctttgctggagacaagcaaaggt
cagctgatctacgaatctccaatcacttgtgagtatttggatgaagcatatccagagaag
aagttgtatcctgaagacccctatgagaaggcttatcagaagatgctcttggaattcttc
tcccagctaactcctgtgacctacaagtactttctggccaacagaaatggagaagatgca
tctgcactgaaagaggaattcaccaaaaagcttctcaaacttgaggagattctagccaac
cacaagacgaagttctttggtgggaactctgtctccatgattgactatcttatgtggcct
tggtttgagcgtctggaggcttaccatttacatgactgtctgaaccataccccaacacta
aagcactgggtggaatccatgcagctggatcctgctgttaaagctacgataacagatccg
cagacatacaaaggttatttggagctgtatgtgaagaacagccctgaggcctgtgattac
agggtctga

DBGET integrated database retrieval system