KEGG   Gekko japonicus: 107118488Help
Entry
107118488         CDS       T04299                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
gja  Gekko japonicus
Brite
Enzymes [BR:gja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107118488 (TMPRSS9)
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107118488 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1130 aa AA seqDB search
MAGSFPSRTRHSEAGMDPQAIAVKPVLGEEKGEAAVGSGTCCKVTVATVLVSAVTAVSAG
ILMAFHLKQEVLFEHLVELRGIRYDGSLQCQNSDYHRTLTPILERLVSWLLGEGELLSPG
LEEEVLRRGLAATLDKQGVPLAAYGTISSAILTGSCLGNAFACHDGQCVAVENVECDYHR
DCMDGSDEAECAGAFETFRKRKNVGSECLGRWQAGPEGTVLVLLGQSQHSTPLILSFPPP
PHVSLSVCGIRPALQTANRIVGGSEALRGEFPWQVSLRENGEHFCGATILTARWLVSAAH
CFNELHDPSSWTAYVGTIWLSNTGSSFAKAGVGHIVKHPSYNTDTADYDVALLHLADPLV
FTKYVQPVCLPAASHVFPPGRKCLISGWGYLKEDFLVKPELLQKATVELLDQTLCASLYT
NALTDRMLCAGYLEGKIDSCQGDSGGPLVCKEPSGRFFLAGIVSWGIGCAEANRPGVYAR
VTKLRDWILHTIATFTPPTTIPTTVSTLLDNASLSEGSSTVSEHGPSTAPASTATSRPVT
APRPPECGRRPAFSKPVKIVGGLDASRGEVPWQVSLKEGLRHFCGATIVGDRWLLSAAHC
FNHTKPEYITAYAGATLLSAAESSSVKVSVRRVVLHPSYNPLLLDFDVAVLELARPLLFG
KYVQPVCLPLAIHKFPVGKRCSISGWGSVREGNTTKPEHLQRASINIIDQKTCSVLYNFS
LTERMICAGFLEGRVDSCQGDSGGPLTCEETPGVFYLAGLVSWGAGCAQPRKPGVYTRIT
KLKGWILDTISPRPSTTLTSTSKTTAGTTSSSPGTTQTTSQTTPDPSTSAGTVSTPLAST
PKIIQFPVVPCTLTTFKCSSKVCIGKLNPECDDIVDCSNGRDEWNCTSTAQVGIQSQIVG
GSGAARGEWPWQVSLWLRRKEHKCGAVVIGERWLLSAAHCFDIYSDPKMWVAILGTPFLS
GLDGRVERIFHIHRHPFYNVYTLDYDVALLELAFPLRYTSTIRPICIPDSSHVFSEGVRC
FITGWGSTKEGGLMSKHLQKAAVNLIGEQDCKKFYPIQISGRMVCAGFLQGTVDSCSGDA
GGPLACKEPSGRWFLAGVTSWGYGCARPFFPGVYTRVTAVRGWIGQHLKV
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggctgggagctttcccagcagaaccagacattccgaggcaggcatggacccgcaagcc
attgctgttaagccggtgctgggcgaagaaaaaggggaagcagcggtgggtagtgggacg
tgttgcaaggtgacggtggccaccgtccttgtcagcgccgtcacagctgtgtcagccggg
atcctaatggccttccacttgaaacaagaggtcctctttgagcacctggtggagctgcga
gggatccggtatgacggcagcctgcagtgtcagaactccgactaccaccgcacgttgact
cccatcctggagaggctggtaagctggctcctcggggagggagaactgctcagcccgggc
ttagaagaagaggtgctcaggcgggggctggcagccaccctggacaagcagggggttcct
ctggctgcctacggtaccatttcttcagccatcctgacaggcagctgtctggggaatgcc
ttcgcctgccacgatggccagtgcgtggccgtggagaacgtggaatgcgactaccaccgg
gactgcatggacggctccgatgaggctgagtgcgctggtgcctttgagaccttcagaaag
agaaaaaatgttggctctgagtgtttgggtagatggcaagcgggtcccgaaggcacggtc
cttgtcctcctggggcagtcccagcacagcacgcctttaatcctctctttcccccccccc
ccccatgtctctctttctgtctgtggcattaggcccgccctgcagacggcaaaccggatt
gttgggggctcggaggccttgcggggggagttcccctggcaggtcagcctgcgggagaat
ggcgaacacttctgcggggcgaccattctgacggcgaggtggctggtgtctgcagctcac
tgctttaatgagcttcatgaccccagctcctggacagcctacgtgggcactatctggctg
agtaacaccggcagcagctttgccaaggccggcgtgggccacatcgtgaagcacccgtcc
tacaacaccgacacggccgactatgacgtggccctgctccatctggctgacccgctggtc
ttcaccaaatacgtccagcccgtgtgcctcccggccgccagccacgtcttccccccgggc
agaaagtgcctcatctcagggtggggttacctcaaggaggactttttggtgaagccagag
ctcctccagaaggccacagtggagcttctggaccagaccctctgtgccagtctgtacacc
aacgctctcacggacaggatgctttgtgccggctacctggaggggaaaattgactcctgc
cagggggattctggggggccgctggtctgcaaagagccctccggacgcttcttcctagcg
ggcatcgtgagctgggggatcggctgcgcggaggccaaccgcccaggggtctacgcccgg
gtaaccaagctccgggactggatccttcacaccattgccacgttcacgcctccgacgacc
atcccgaccacagtttccacactgctggacaacgcttccctttcagaggggtcaagtacc
gtcagtgagcacggccccagcacggccccagcgtccactgccacgagcaggccggtgacg
gcgccccgccccccagagtgcggccggagaccagccttctccaagcccgtcaaaattgtg
ggcggactggacgcatcccggggggaagtgccttggcaggtcagcctgaaggaggggctg
cggcacttctgtggggccaccatcgtcggggaccgctggctgctctcggccgcacactgc
tttaatcacaccaagccagagtacatcaccgcctacgcaggcgccacgctgctgtcggcg
gcggagagcagctccgtgaaggtcagcgtcaggcgggtggtgctgcacccgtcctacaac
cctctgctgctggacttcgacgtggccgtcctggagctggccaggcccctcctcttcggc
aaatacgtccagcccgtctgcctcccgctcgccatccacaagtttcctgtgggcaagagg
tgctccatctccggctggggcagcgtccgtgaaggcaacaccaccaagcccgagcacctg
cagagagcctccatcaacatcatcgatcagaagacctgcagcgtcctgtacaacttctcc
ctcaccgaacggatgatctgtgccgggttcctggaggggagggtggattcctgccagggt
gactctggcggacccctgacatgcgaggagacgcctggtgtgttctacttggcagggctg
gtgagctggggggccggctgcgcacagcccaggaagccaggggtgtacacccggatcacc
aagctcaaaggctggatcctggacaccatctcgccccgccccagcaccaccctcacgtcc
acctccaagaccacggctggcaccacctccagctcacccggcactacccagacgactagc
cagacaacccccgatccaagcaccagtgctggcaccgtatctacaccactagcgagcacg
ccgaagatcatccagttcccagttgtaccgtgcacgctgaccactttcaagtgctccagc
aaagtctgcattgggaaactgaacccagagtgtgacgacattgtggactgcagcaacggc
cgagatgaatggaactgcacttccacggcacaagtagggattcagagccagatcgtgggg
ggcagcggagcggcccgtggggagtggccgtggcaggtgagcctgtggctgcggaggaag
gagcacaagtgcggggcagtcgtgatcggcgagcggtggctgctgtcggctgctcattgc
ttcgacatttacagtgaccccaagatgtgggttgccatcctggggacaccgttcctcagt
ggcctggatgggagagtggagagaatcttccacatccacaggcacccattttacaacgtc
tacacgctggactacgacgtggccctcctggagctggctttccccctgcgctacaccagc
accatcaggcccatctgcataccggacagctcccacgtcttcagcgaaggggtgcggtgc
ttcatcaccggctggggctccactaaggagggaggtctgatgtccaagcacttgcagaag
gctgccgtgaacctgatcggagagcaagactgcaagaagttctaccccatccagatcagc
gggaggatggtgtgcgccggcttcctgcagggcacggtcgacagctgctcgggcgacgca
ggtggacccctagcctgcaaagagccttcagggaggtggttcctggcaggcgtcaccagc
tggggctacggctgcgcacggcctttcttccccggcgtttacaccagggtgacggcggtg
cggggttggatcgggcagcatctcaaggtgtga

DBGET integrated database retrieval system