KEGG   Gekko japonicus: 107119975Help
Entry
107119975         CDS       T04299                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
gja  Gekko japonicus
Brite
Enzymes [BR:gja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     107119975 (PCSK1)
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S8: subtilisin family
   107119975 (PCSK1)
Chaperones and folding catalysts [BR:gja03110]
 Intramolecular chaperones
  Subtilisin family
   107119975 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 107119975
NCBI-ProteinID: XP_015278094
LinkDB All DBs
Position
Un
AA seq 748 aa AA seqDB search
MEERRWAEQCVAVALLCAWSVAILAKAERQFVNEWAAEIPGGPEAAKAIADELEYELLGQ
IGSLENHYLFRHKSHARRSRRSATHITKRLADDHRVSWVEQQYEKKRNKRSVLRDTAENR
FNDPMWNKQWYLQDTRMSPSLPKLDLHVLPVWQKGLTGKGVVITVLDDGLEWNHTDIYNN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNLKCGVGVAYNSRVGGIRM
LDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIRKGRKGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSSLATAYSSGDY
TDQKIISADLHNDCTQTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEFDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWKGVGEKKECIVKDNSFEPRLLR
AGGEVTIEIPTTACEGQENAIKSLEHVQLEATIEYSRRGDLHVTLTSPSGTSTVLLAERQ
RDKSPNGFKDWDFMSVHTWGENPTGTWTLKIIDMSRRTQNEGRIVNWKLILHGTSSQPDH
MQQPRVYTSYNTVQNDRRGVEKMIDFAEDHTTVENLSENPKATESTTHSIEKGQELAPSD
AMLRLLQSAFSGQMGGNKVPKKTLNEKLNIPYEHLYKAFDKLNQPPQLRDSEESLYSDYV
DLFYNSKPYKHRDDRLVQALVDILNDEN
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggaagagagacggtgggcagagcaatgcgttgctgtggctctgctctgtgcctggagt
gtagctattctggccaaggcagagaggcagtttgtcaatgaatgggcggcagagatccca
ggaggtccagaggcggcaaaggccattgcagatgaactggagtatgaacttctggggcag
attggatcacttgaaaaccattacttatttagacataagagccatgctagaaggtctcga
agaagtgctactcacatcactaaaagactcgcagatgatcatcgtgtatcttgggtggaa
caacagtatgaaaagaagcgaaataaacgttcggtattgagagatacagctgaaaatcgt
tttaatgacccaatgtggaataaacaatggtatctgcaagacacaagaatgtctccatct
ttaccaaaactggatcttcatgtccttcctgtgtggcaaaagggactcacaggcaaaggg
gttgtcataactgtgcttgatgatggtttggagtggaatcacacagacatttataataat
tatgatcctgaggcaagttatgatttcaatgacaatgatcacgatccatttcccagatat
gatccaacaaatgaaaataaacatggaacacggtgtgcaggagagattgccatgcaagcc
aacaacttaaaatgtggagttggagttgcatacaattcaagagttgggggcataagaatg
ctggatggaatagtcactgatgccatcgaagccagttccattgggttcaatccagatcat
gtggatatctacagtgccagctggggcccaaatgatgatgggaaaactgttgaggggcct
ggccgcctggcacagaaggcatttgaatatgggatcaggaagggccggaaaggaaaaggc
tccatttttgtctgggcttctggcaatggtggccgccaaggagataactgtgactgtgat
ggctacactgacagtatttacacaatctccatcagcagtgcttctcagcaaggcctttct
ccctggtatgcagagaagtgctcttcatcactggccacagcatacagcagtggggattat
actgaccagaaaattataagtgctgatcttcacaatgactgcactcagactcacactggg
acctccgcttctgctcccttagctgcagggatttttgctctagcccttgaagccaatcct
aatttaacctggagggatatgcaacatttggtagtatggacatctgaatttgatccattg
gccaacaatccaggatggaaaaaaaatggagctgggctgatggtgaacagcagatttgga
tttgggttactgaatgcaaaagcactagtagatctggcagatcctagaacctggaaagga
gtgggggaaaagaaagagtgcattgttaaggacaacagctttgagccaaggttgttaaga
gctggtggtgaagtgaccattgaaattcccacaacagcatgtgaaggtcaagaaaatgcc
attaaatcactggaacatgtacaattggaagcaacaattgaatattcccgtagaggtgat
cttcatgtgaccctaacctctccatcagggaccagtactgttttactggctgagcggcaa
agagataaatcacccaatggctttaaagattgggatttcatgtcagttcatacttggggg
gagaatccaacaggcacatggactttaaaaattattgatatgtctagaagaacgcaaaat
gaaggaagaattgtgaactggaaattgatcttgcatggcacttcatctcagccggaccac
atgcagcaaccccgtgtctacacatcatacaatacagttcaaaatgacaggagaggggtc
gaaaagatgatagactttgcggaggaccacaccactgtggagaacctaagtgaaaacccc
aaagcgacagaaagtactacccacagcattgagaaagggcaggagctggccccatcagac
gcaatgctccgtctgctgcaaagtgcatttagtggtcagatgggcggaaataaagtacca
aagaagactctgaatgaaaaactaaatattccatatgaacatttgtacaaggctttcgat
aagctaaatcaacccccccagttgagggactcagaggagtctctatatagtgactatgtt
gatcttttttacaattccaaaccatataagcatagagatgacagattagtgcaagccttg
gttgatattctgaatgatgaaaactaa

DBGET integrated database retrieval system